eF-site ID 6int-D
PDB Code 6int
Chain D

click to enlarge
Title xylose isomerase from Paenibacillus sp. R4
Classification ISOMERASE
Compound Xylose isomerase
Source (6INT)
Sequence D:  YFDHVGTVKFEGKSSTNPLAFKFYNPDEIILGKTMREHLR
FGVAYLSGMELAKARVEACFELLNILDVDYFCFHDRDIAP
EGDTLQETNRNLDEIVALIKQHMHSSGKKLLWNTANMFTN
PRFVHGAATTSNADVFAYAAAQVKKALDHGKELGAENYVF
WGGREGYESLLNTDLGLELDNLARFLQLAVDYAKEIGFDA
QFLIEPKPKEPSKHQYDFDAATTLQFLQKYDLAKHFKLNL
EANHATLAGHTFEHELRVARINGALGSIDANQGDLLLGWD
TDEFPTDLYASTLAMYEILQNEGGIGRGGVNFDAKVRRTS
FEPIDVVYAHINGMDAFARGLQVAAKLIEDRAFDNVIEER
YASFTKGIGADIVSGKANFHTLEAYALQNNPITNKSGRVE
LLRSILNQYIINV
Description (1)  Xylose isomerase


Functional site

1) chain D
residue 266
type
ligand
sequence E
description binding site for residue CA D 501
source : AD1

2) chain D
residue 269
type
ligand
sequence H
description binding site for residue CA D 501
source : AD1

3) chain D
residue 305
type
ligand
sequence D
description binding site for residue CA D 501
source : AD1

4) chain D
residue 307
type
ligand
sequence D
description binding site for residue CA D 501
source : AD1

5) chain D
residue 230
type
ligand
sequence E
description binding site for residue CA D 502
source : AD2

6) chain D
residue 266
type
ligand
sequence E
description binding site for residue CA D 502
source : AD2

7) chain D
residue 294
type
ligand
sequence D
description binding site for residue CA D 502
source : AD2

8) chain D
residue 338
type
ligand
sequence D
description binding site for residue CA D 502
source : AD2

9) chain D
residue 191
type
ligand
sequence G
description binding site for residue CA D 503
source : AD3

10) chain D
residue 203
type
ligand
sequence E
description binding site for residue CA D 503
source : AD3


Display surface

Download
Links