eF-site ID 6int-B
PDB Code 6int
Chain B

click to enlarge
Title xylose isomerase from Paenibacillus sp. R4
Classification ISOMERASE
Compound Xylose isomerase
Source (6INT)
Sequence B:  FDHVGTVKFEGKSSTNPLAFKFYNPDEIILGKTMREHLRF
GVAYLSGMELAKARVEACFELLNILDVDYFCFHDRDIAPE
GDTLQETNRNLDEIVALIKQHMHSSGKKLLWNTANMFTNP
RFVHGAATTSNADVFAYAAAQVKKALDHGKELGAENYVFW
GGREGYESLLNTDLGLELDNLARFLQLAVDYAKEIGFDAQ
FLIEPKPKEPSKHQYDFDAATTLQFLQKYDLAKHFKLNLE
ANHATLAGHTFEHELRVARINGALGSIDANQGDLLLGWDT
DEFPTDLYASTLAMYEILQNEGGIGRGGVNFDAKVRRTSF
EPIDVVYAHINGMDAFARGLQVAAKLIEDRAFDNVIEERY
ASFTKGIGADIVSGKANFHTLEAYALQNNPITNKSGRVEL
LRSILNQYIINV
Description (1)  Xylose isomerase


Functional site

1) chain B
residue 266
type
ligand
sequence E
description binding site for residue CA B 501
source : AC4

2) chain B
residue 269
type
ligand
sequence H
description binding site for residue CA B 501
source : AC4

3) chain B
residue 305
type
ligand
sequence D
description binding site for residue CA B 501
source : AC4

4) chain B
residue 307
type
ligand
sequence D
description binding site for residue CA B 501
source : AC4

5) chain B
residue 230
type
ligand
sequence E
description binding site for residue CA B 502
source : AC5

6) chain B
residue 266
type
ligand
sequence E
description binding site for residue CA B 502
source : AC5

7) chain B
residue 294
type
ligand
sequence D
description binding site for residue CA B 502
source : AC5

8) chain B
residue 338
type
ligand
sequence D
description binding site for residue CA B 502
source : AC5

9) chain B
residue 191
type
ligand
sequence G
description binding site for residue CA B 503
source : AC6

10) chain B
residue 203
type
ligand
sequence E
description binding site for residue CA B 503
source : AC6


Display surface

Download
Links