eF-site ID 6int-A
PDB Code 6int
Chain A

click to enlarge
Title xylose isomerase from Paenibacillus sp. R4
Classification ISOMERASE
Compound Xylose isomerase
Source (6INT)
Sequence A:  YFDHVGTVKFEGKSSTNPLAFKFYNPDEIILGKTMREHLR
FGVAYLSGMELAKARVEACFELLNILDVDYFCFHDRDIAP
EGDTLQETNRNLDEIVALIKQHMHSSGKKLLWNTANMFTN
PRFVHGAATTSNADVFAYAAAQVKKALDHGKELGAENYVF
WGGREGYESLLNTDLGLELDNLARFLQLAVDYAKEIGFDA
QFLIEPKPKEPSKHQYDFDAATTLQFLQKYDLAKHFKLNL
EANHATLAGHTFEHELRVARINGALGSIDANQGDLLLGWD
TDEFPTDLYASTLAMYEILQNEGGIGRGGVNFDAKVRRTS
FEPIDVVYAHINGMDAFARGLQVAAKLIEDRAFDNVIEER
YASFTKGIGADIVSGKANFHTLEAYALQNNPITNKSGRVE
LLRSILNQYIINV
Description (1)  Xylose isomerase


Functional site

1) chain A
residue 191
type
ligand
sequence G
description binding site for residue CA A 501
source : AC1

2) chain A
residue 203
type
ligand
sequence E
description binding site for residue CA A 501
source : AC1

3) chain A
residue 230
type
ligand
sequence E
description binding site for residue CA A 502
source : AC2

4) chain A
residue 266
type
ligand
sequence E
description binding site for residue CA A 502
source : AC2

5) chain A
residue 294
type
ligand
sequence D
description binding site for residue CA A 502
source : AC2

6) chain A
residue 338
type
ligand
sequence D
description binding site for residue CA A 502
source : AC2

7) chain A
residue 266
type
ligand
sequence E
description binding site for residue CA A 503
source : AC3

8) chain A
residue 269
type
ligand
sequence H
description binding site for residue CA A 503
source : AC3

9) chain A
residue 305
type
ligand
sequence D
description binding site for residue CA A 503
source : AC3

10) chain A
residue 307
type
ligand
sequence D
description binding site for residue CA A 503
source : AC3


Display surface

Download
Links