eF-site ID 6ink-B PDB Code 6ink Chain B click to enlarge Title Crystal structure of PDE4D complexed with a novel inhibitor Classification HYDROLASE/HYDROLASE INHIBITOR Compound cAMP-specific 3',5'-cyclic phosphodiesterase 4D Source (PDE4D_HUMAN) Sequence B:  VLAKELEDVNKWGLHVFRIAELSGNRPLTVIMHTIFQERD LLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQ STHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQ FLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQ NLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETK KVTVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWT DRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFI DYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIP Description Functional site 1) chain B residue 164 type sequence H description binding site for residue ZN B 501 source : AC6 2) chain B residue 200 type sequence H description binding site for residue ZN B 501 source : AC6 3) chain B residue 201 type sequence D description binding site for residue ZN B 501 source : AC6 4) chain B residue 318 type sequence D description binding site for residue ZN B 501 source : AC6 5) chain B residue 201 type sequence D description binding site for residue MG B 502 source : AC7 6) chain B residue 159 type sequence Y description binding site for residue AKU B 503 source : AC8 7) chain B residue 160 type sequence H description binding site for residue AKU B 503 source : AC8 8) chain B residue 321 type sequence N description binding site for residue AKU B 503 source : AC8 9) chain B residue 336 type sequence I description binding site for residue AKU B 503 source : AC8 10) chain B residue 357 type sequence M description binding site for residue AKU B 503 source : AC8 11) chain B residue 369 type sequence Q description binding site for residue AKU B 503 source : AC8 12) chain B residue 372 type sequence F description binding site for residue AKU B 503 source : AC8 13) chain B residue 208 type sequence S description binding site for residue EDO B 504 source : AC9 14) chain B residue 340 type sequence F description binding site for residue EDO B 504 source : AC9 15) chain B residue 356 type sequence P description binding site for residue EDO B 504 source : AC9 16) chain B residue 262 type sequence K description binding site for residue EDO B 505 source : AD1 17) chain B residue 265 type sequence I description binding site for residue EDO B 505 source : AD1 18) chain B residue 266 type sequence D description binding site for residue EDO B 505 source : AD1 19) chain B residue 160 type BINDING sequence H description BINDING => ECO:0000269|PubMed:14609333, ECO:0000269|PubMed:15260978, ECO:0007744|PDB:1PTW, ECO:0007744|PDB:1TB7 source Swiss-Prot : SWS_FT_FI2 20) chain B residue 321 type BINDING sequence N description BINDING => ECO:0000269|PubMed:14609333, ECO:0000269|PubMed:15260978, ECO:0007744|PDB:1PTW, ECO:0007744|PDB:1TB7 source Swiss-Prot : SWS_FT_FI2 21) chain B residue 369 type BINDING sequence Q description BINDING => ECO:0000269|PubMed:14609333, ECO:0000269|PubMed:15260978, ECO:0007744|PDB:1PTW, ECO:0007744|PDB:1TB7 source Swiss-Prot : SWS_FT_FI2 22) chain B residue 201 type BINDING sequence D description BINDING => ECO:0000269|PubMed:14609333, ECO:0007744|PDB:1PTW source Swiss-Prot : SWS_FT_FI5 23) chain B residue 372 type BINDING sequence F description BINDING => ECO:0000269|PubMed:14609333, ECO:0007744|PDB:1PTW source Swiss-Prot : SWS_FT_FI5 24) chain B residue 160 type ACT_SITE sequence H description Proton donor => ECO:0000250|UniProtKB:Q07343 source Swiss-Prot : SWS_FT_FI1 25) chain B residue 200 type BINDING sequence H description BINDING => ECO:0000269|PubMed:14609333, ECO:0000269|PubMed:15260978, ECO:0000269|PubMed:15576036, ECO:0000269|PubMed:17582435, ECO:0007744|PDB:1PTW, ECO:0007744|PDB:1TB7, ECO:0007744|PDB:1TBB, ECO:0007744|PDB:1XOM, ECO:0007744|PDB:1XON, ECO:0007744|PDB:1XOQ, ECO:0007744|PDB:1XOR, ECO:0007744|PDB:2PW3 source Swiss-Prot : SWS_FT_FI4 26) chain B residue 318 type BINDING sequence D description BINDING => ECO:0000269|PubMed:14609333, ECO:0000269|PubMed:15260978, ECO:0000269|PubMed:15576036, ECO:0000269|PubMed:17582435, ECO:0007744|PDB:1PTW, ECO:0007744|PDB:1TB7, ECO:0007744|PDB:1TBB, ECO:0007744|PDB:1XOM, ECO:0007744|PDB:1XON, ECO:0007744|PDB:1XOQ, ECO:0007744|PDB:1XOR, ECO:0007744|PDB:2PW3 source Swiss-Prot : SWS_FT_FI4 27) chain B residue 164 type BINDING sequence H description BINDING => ECO:0000269|PubMed:14609333, ECO:0000269|PubMed:15260978, ECO:0000269|PubMed:15576036, ECO:0000269|PubMed:17582435, ECO:0007744|PDB:1PTW, ECO:0007744|PDB:1TB7, ECO:0007744|PDB:1TBB, ECO:0007744|PDB:1XOM, ECO:0007744|PDB:1XON, ECO:0007744|PDB:1XOQ, ECO:0007744|PDB:2PW3 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links