eF-site ID 6inb-A
PDB Code 6inb
Chain A

click to enlarge
Title Crystal structure of an acetolactate decarboxylase from Klebsiella pneumoniae
Classification UNKNOWN FUNCTION
Compound Alpha-acetolactate decarboxylase
Source (W9BHF3_KLEPN)
Sequence A:  SVLYQTSLMSALLSGVYEGSTTIADLLKHGDFGLGTFNEL
DGELIAFSSQVYQLRADGSARNAQPEQKTPFAVMTWFQPQ
YRKTFDHPVSRQQLHEVIDQQIPSDNLFCALRIDGHFRHA
HTRTVPRQTPPYRAMTDVLDDQPVFRFNQREGVLVGFRTP
QHMQGINVAGYHEHFITDDRKGGGHLLDYQLDHGVLTFGE
IHKLMIDLPADSAFLQANL
Description (1)  Alpha-acetolactate decarboxylase (E.C.4.1.1.5)


Functional site

1) chain A
residue 69
type
ligand
sequence E
description binding site for residue ZN A 301
source : AC1

2) chain A
residue 198
type
ligand
sequence H
description binding site for residue ZN A 301
source : AC1

3) chain A
residue 200
type
ligand
sequence H
description binding site for residue ZN A 301
source : AC1

4) chain A
residue 211
type
ligand
sequence H
description binding site for residue ZN A 301
source : AC1

5) chain A
residue 104
type
ligand
sequence Q
description binding site for residue CL A 302
source : AC2

6) chain A
residue 145
type
ligand
sequence H
description binding site for residue CL A 302
source : AC2

7) chain A
residue 147
type
ligand
sequence H
description binding site for residue CL A 302
source : AC2

8) chain A
residue 174
type
ligand
sequence N
description binding site for residue CL A 302
source : AC2


Display surface

Download
Links