eF-site ID 6ih6-C PDB Code 6ih6 Chain C click to enlarge Title Phosphite Dehydrogenase mutant I151R/P176R/M207A from Ralstonia sp. 4506 in complex with non-natural cofactor Nicotinamide Cytosine dinucleotide Classification OXIDOREDUCTASE Compound Phosphite dehydrogenase Source (G4XDR8_9RALS) Sequence C:  MKPKVVLTHWVHPEIIELLSASADVIPNTTRETLPRSEVI ARAKDADALMAFMPDSIDSAFLEECPKLRVIGAALKGYDN FDVNACTRHGVWLTIVPDLLTIPTAELTIGLLLGLTRHML EGDRQIRSGHFQGWRPTLYGSGLTGKTLGIRGMGAVGRAI AQRLAGFEMNLLYCDRIPLNAEQEKAWHVQRVTLDELLEK CDYVVPAVPMAAETLHLIDATALAKMKTGSYLINACRGSV VDENAVIAALASGKLAGYAADVFEMEEWIRADRPQAIPKA LLDNTAQTFFTPHLGSAVKEVRLEIERQAAMNIIQALAGE KPMGAINQPY Description Functional site 1) chain C residue 208 type sequence V description binding site for Di-peptide PRO C 209 and ARG C 237 source : AC3 2) chain C residue 210 type sequence M description binding site for Di-peptide PRO C 209 and ARG C 237 source : AC3 3) chain C residue 234 type sequence N description binding site for Di-peptide PRO C 209 and ARG C 237 source : AC3 4) chain C residue 236 type sequence C description binding site for Di-peptide PRO C 209 and ARG C 237 source : AC3 5) chain C residue 238 type sequence G description binding site for Di-peptide PRO C 209 and ARG C 237 source : AC3 6) chain C residue 239 type sequence S description binding site for Di-peptide PRO C 209 and ARG C 237 source : AC3 7) chain C residue 240 type sequence V description binding site for Di-peptide PRO C 209 and ARG C 237 source : AC3 8) chain C residue 262 type sequence V description binding site for Di-peptide PRO C 209 and ARG C 237 source : AC3

Display surface Download Links