eF-site ID 6ih5-B PDB Code 6ih5 Chain B click to enlarge Title Crystal structure of Phosphite Dehydrogenase mutant I151R/P176E from Ralstonia sp. 4506 in complex with non-natural cofactor Nicotinamide Cytosine dinucleotide Classification OXIDOREDUCTASE Compound Phosphite dehydrogenase Source (G4XDR8_9RALS) Sequence B:  KPKVVLTHWVHPEIIELLSASADVIPNTTRETLPRSEVIA RAKDADALMAFMPDSIDSAFLEECPKLRVIGAALKGYDNF DVNACTRHGVWLTIVPDLLTIPTAELTIGLLLGLTRHMLE GDRQIRSGHFQGWRPTLYGSGLTGKTLGIRGMGAVGRAIA QRLAGFEMNLLYCDEIPLNAEQEKAWHVQRVTLDELLEKC DYVVPMVPMAAETLHLIDATALAKMKTGSYLINACRGSVV DENAVIAALASGKLAGYAADVFEMEEWIRADRPQAIPKAL LDNTAQTFFTPHLGSAVKEVRLEIERQAAMNIIQALAGEK PMGAINQPY Description Functional site 1) chain B residue 76 type sequence K description binding site for residue A7R B 400 source : AC1 2) chain B residue 104 type sequence T description binding site for residue A7R B 400 source : AC1 3) chain B residue 151 type sequence R description binding site for residue A7R B 400 source : AC1 4) chain B residue 153 type sequence M description binding site for residue A7R B 400 source : AC1 5) chain B residue 154 type sequence G description binding site for residue A7R B 400 source : AC1 6) chain B residue 155 type sequence A description binding site for residue A7R B 400 source : AC1 7) chain B residue 156 type sequence V description binding site for residue A7R B 400 source : AC1 8) chain B residue 175 type sequence D description binding site for residue A7R B 400 source : AC1 9) chain B residue 176 type sequence E description binding site for residue A7R B 400 source : AC1 10) chain B residue 207 type sequence M description binding site for residue A7R B 400 source : AC1 11) chain B residue 208 type sequence V description binding site for residue A7R B 400 source : AC1 12) chain B residue 209 type sequence P description binding site for residue A7R B 400 source : AC1 13) chain B residue 235 type sequence A description binding site for residue A7R B 400 source : AC1 14) chain B residue 236 type sequence C description binding site for residue A7R B 400 source : AC1 15) chain B residue 261 type sequence D description binding site for residue A7R B 400 source : AC1 16) chain B residue 293 type sequence H description binding site for residue A7R B 400 source : AC1 17) chain B residue 295 type sequence G description binding site for residue A7R B 400 source : AC1

Display surface Download Links