eF-site ID 6iej-B
PDB Code 6iej
Chain B

click to enlarge
Title The C2 domain of cytosolic phospholipase A2 alpha bound to phosphatidylcholine
Classification HYDROLASE
Compound Cytosolic phospholipase A2
Source (PA24A_CHICK)
Sequence B:  SYSHVFTVTVRKATNVTKGAIGDMLDTPDPYVELFIPSAP
DCRKRTKHFNNDVNPVWNETFEFILDPNQDNVLEVTLMDA
NYVMDETLGMATFPISSLKLGEKKEVQLTFNNVTEMTLEL
SLEVCS
Description (1)  Cytosolic phospholipase A2 (E.C.3.1.1.4)


Functional site

1) chain B
residue 66
type
ligand
sequence D
description binding site for residue MG A 204
source : AC4

2) chain B
residue 68
type
ligand
sequence N
description binding site for residue MG A 204
source : AC4

3) chain B
residue 40
type
ligand
sequence D
description binding site for residue CA B 201
source : AC6

4) chain B
residue 43
type
ligand
sequence D
description binding site for residue CA B 201
source : AC6

5) chain B
residue 93
type
ligand
sequence D
description binding site for residue CA B 201
source : AC6

6) chain B
residue 94
type
ligand
sequence A
description binding site for residue CA B 201
source : AC6

7) chain B
residue 95
type
ligand
sequence N
description binding site for residue CA B 201
source : AC6

8) chain B
residue 40
type
ligand
sequence D
description binding site for residue CA B 202
source : AC7

9) chain B
residue 41
type
ligand
sequence T
description binding site for residue CA B 202
source : AC7

10) chain B
residue 43
type
ligand
sequence D
description binding site for residue CA B 202
source : AC7

11) chain B
residue 65
type
ligand
sequence N
description binding site for residue CA B 202
source : AC7

12) chain B
residue 41
type
ligand
sequence T
description binding site for residue CA B 203
source : AC8

13) chain B
residue 65
type
ligand
sequence N
description binding site for residue CA B 203
source : AC8

14) chain B
residue 39
type
ligand
sequence L
description binding site for residue HXG B 204
source : AC9

15) chain B
residue 40
type
ligand
sequence D
description binding site for residue HXG B 204
source : AC9

16) chain B
residue 43
type
ligand
sequence D
description binding site for residue HXG B 204
source : AC9

17) chain B
residue 62
type
ligand
sequence H
description binding site for residue HXG B 204
source : AC9

18) chain B
residue 64
type
ligand
sequence N
description binding site for residue HXG B 204
source : AC9

19) chain B
residue 65
type
ligand
sequence N
description binding site for residue HXG B 204
source : AC9

20) chain B
residue 94
type
ligand
sequence A
description binding site for residue HXG B 204
source : AC9

21) chain B
residue 95
type
ligand
sequence N
description binding site for residue HXG B 204
source : AC9

22) chain B
residue 96
type
ligand
sequence Y
description binding site for residue HXG B 204
source : AC9

23) chain B
residue 38-41
type binding
ligand HXG: 1,2-dihexanoyl-sn-glycero-3-phosphocholine
sequence MLDT
description 1,2-dihexanoyl-sn-glycero-3-phosphocholine binding site
source pdb_hetatom : HXG_6iej_B_204

24) chain B
residue 43
type binding
ligand HXG: 1,2-dihexanoyl-sn-glycero-3-phosphocholine
sequence D
description 1,2-dihexanoyl-sn-glycero-3-phosphocholine binding site
source pdb_hetatom : HXG_6iej_B_204

25) chain B
residue 62
type binding
ligand HXG: 1,2-dihexanoyl-sn-glycero-3-phosphocholine
sequence H
description 1,2-dihexanoyl-sn-glycero-3-phosphocholine binding site
source pdb_hetatom : HXG_6iej_B_204

26) chain B
residue 64-65
type binding
ligand HXG: 1,2-dihexanoyl-sn-glycero-3-phosphocholine
sequence NN
description 1,2-dihexanoyl-sn-glycero-3-phosphocholine binding site
source pdb_hetatom : HXG_6iej_B_204

27) chain B
residue 94-96
type binding
ligand HXG: 1,2-dihexanoyl-sn-glycero-3-phosphocholine
sequence ANY
description 1,2-dihexanoyl-sn-glycero-3-phosphocholine binding site
source pdb_hetatom : HXG_6iej_B_204

28) chain B
residue 38
type binding
ligand HXG: 1,2-dihexanoyl-sn-glycero-3-phosphocholine
sequence M
description 1,2-dihexanoyl-sn-glycero-3-phosphocholine binding site
source pdb_hetatom : HXG_6iej_A_205

29) chain B
residue 34
type binding
ligand HXG: 1,2-dihexanoyl-sn-glycero-3-phosphocholine
sequence A
description 1,2-dihexanoyl-sn-glycero-3-phosphocholine binding site
source pdb_hetatom : HXG_6iej_C_205


Display surface

Download
Links