eF-site ID 6iej-ABC
PDB Code 6iej
Chain A, B, C

click to enlarge
Title The C2 domain of cytosolic phospholipase A2 alpha bound to phosphatidylcholine
Classification HYDROLASE
Compound Cytosolic phospholipase A2
Source (PA24A_CHICK)
Sequence A:  SYSHVFTVTVRKATNVTKGAIGDMLDTPDPYVELFIPSAP
DCRKRTKHFNNDVNPVWNETFEFILDPNQDNVLEVTLMDA
NYVMDETLGMATFPISSLKLGEKKEVQLTFNNVTEMTLEL
SLEVCS
B:  SYSHVFTVTVRKATNVTKGAIGDMLDTPDPYVELFIPSAP
DCRKRTKHFNNDVNPVWNETFEFILDPNQDNVLEVTLMDA
NYVMDETLGMATFPISSLKLGEKKEVQLTFNNVTEMTLEL
SLEVCS
C:  SYSHVFTVTVRKATNVTKGAIGDMLDTPDPYVELFIPSAP
DCRKRTKHFNNDVNPVWNETFEFILDPNQDNVLEVTLMDA
NYVMDETLGMATFPISSLKLGEKKEVQLTFNNVTEMTLEL
SLEVCS
Description (1)  Cytosolic phospholipase A2 (E.C.3.1.1.4)


Functional site

1) chain A
residue 40
type
ligand
sequence D
description binding site for residue CA A 201
source : AC1

2) chain A
residue 43
type
ligand
sequence D
description binding site for residue CA A 201
source : AC1

3) chain A
residue 93
type
ligand
sequence D
description binding site for residue CA A 201
source : AC1

4) chain A
residue 94
type
ligand
sequence A
description binding site for residue CA A 201
source : AC1

5) chain A
residue 95
type
ligand
sequence N
description binding site for residue CA A 201
source : AC1

6) chain A
residue 40
type
ligand
sequence D
description binding site for residue CA A 202
source : AC2

7) chain A
residue 41
type
ligand
sequence T
description binding site for residue CA A 202
source : AC2

8) chain A
residue 43
type
ligand
sequence D
description binding site for residue CA A 202
source : AC2

9) chain A
residue 65
type
ligand
sequence N
description binding site for residue CA A 202
source : AC2

10) chain A
residue 65
type
ligand
sequence N
description binding site for residue CA A 203
source : AC3

11) chain A
residue 66
type
ligand
sequence D
description binding site for residue MG A 204
source : AC4

12) chain A
residue 68
type
ligand
sequence N
description binding site for residue MG A 204
source : AC4

13) chain B
residue 66
type
ligand
sequence D
description binding site for residue MG A 204
source : AC4

14) chain B
residue 68
type
ligand
sequence N
description binding site for residue MG A 204
source : AC4

15) chain A
residue 39
type
ligand
sequence L
description binding site for residue HXG A 205
source : AC5

16) chain A
residue 40
type
ligand
sequence D
description binding site for residue HXG A 205
source : AC5

17) chain A
residue 43
type
ligand
sequence D
description binding site for residue HXG A 205
source : AC5

18) chain A
residue 62
type
ligand
sequence H
description binding site for residue HXG A 205
source : AC5

19) chain A
residue 64
type
ligand
sequence N
description binding site for residue HXG A 205
source : AC5

20) chain A
residue 65
type
ligand
sequence N
description binding site for residue HXG A 205
source : AC5

21) chain A
residue 94
type
ligand
sequence A
description binding site for residue HXG A 205
source : AC5

22) chain A
residue 95
type
ligand
sequence N
description binding site for residue HXG A 205
source : AC5

23) chain A
residue 96
type
ligand
sequence Y
description binding site for residue HXG A 205
source : AC5

24) chain B
residue 40
type
ligand
sequence D
description binding site for residue CA B 201
source : AC6

25) chain B
residue 43
type
ligand
sequence D
description binding site for residue CA B 201
source : AC6

26) chain B
residue 93
type
ligand
sequence D
description binding site for residue CA B 201
source : AC6

27) chain B
residue 94
type
ligand
sequence A
description binding site for residue CA B 201
source : AC6

28) chain B
residue 95
type
ligand
sequence N
description binding site for residue CA B 201
source : AC6

29) chain B
residue 40
type
ligand
sequence D
description binding site for residue CA B 202
source : AC7

30) chain B
residue 41
type
ligand
sequence T
description binding site for residue CA B 202
source : AC7

31) chain B
residue 43
type
ligand
sequence D
description binding site for residue CA B 202
source : AC7

32) chain B
residue 65
type
ligand
sequence N
description binding site for residue CA B 202
source : AC7

33) chain B
residue 41
type
ligand
sequence T
description binding site for residue CA B 203
source : AC8

34) chain B
residue 65
type
ligand
sequence N
description binding site for residue CA B 203
source : AC8

35) chain B
residue 39
type
ligand
sequence L
description binding site for residue HXG B 204
source : AC9

36) chain B
residue 40
type
ligand
sequence D
description binding site for residue HXG B 204
source : AC9

37) chain B
residue 43
type
ligand
sequence D
description binding site for residue HXG B 204
source : AC9

38) chain B
residue 62
type
ligand
sequence H
description binding site for residue HXG B 204
source : AC9

39) chain B
residue 64
type
ligand
sequence N
description binding site for residue HXG B 204
source : AC9

40) chain B
residue 65
type
ligand
sequence N
description binding site for residue HXG B 204
source : AC9

41) chain B
residue 94
type
ligand
sequence A
description binding site for residue HXG B 204
source : AC9

42) chain B
residue 95
type
ligand
sequence N
description binding site for residue HXG B 204
source : AC9

43) chain B
residue 96
type
ligand
sequence Y
description binding site for residue HXG B 204
source : AC9

44) chain C
residue 40
type
ligand
sequence D
description binding site for residue CA C 201
source : AD1

45) chain C
residue 43
type
ligand
sequence D
description binding site for residue CA C 201
source : AD1

46) chain C
residue 93
type
ligand
sequence D
description binding site for residue CA C 201
source : AD1

47) chain C
residue 94
type
ligand
sequence A
description binding site for residue CA C 201
source : AD1

48) chain C
residue 95
type
ligand
sequence N
description binding site for residue CA C 201
source : AD1

49) chain C
residue 40
type
ligand
sequence D
description binding site for residue CA C 202
source : AD2

50) chain C
residue 41
type
ligand
sequence T
description binding site for residue CA C 202
source : AD2

51) chain C
residue 43
type
ligand
sequence D
description binding site for residue CA C 202
source : AD2

52) chain C
residue 65
type
ligand
sequence N
description binding site for residue CA C 202
source : AD2

53) chain C
residue 41
type
ligand
sequence T
description binding site for residue CA C 203
source : AD3

54) chain C
residue 65
type
ligand
sequence N
description binding site for residue CA C 203
source : AD3

55) chain C
residue 66
type
ligand
sequence D
description binding site for residue MG C 204
source : AD4

56) chain C
residue 66
type
ligand
sequence D
description binding site for residue MG C 204
source : AD4

57) chain C
residue 68
type
ligand
sequence N
description binding site for residue MG C 204
source : AD4

58) chain C
residue 68
type
ligand
sequence N
description binding site for residue MG C 204
source : AD4

59) chain C
residue 39
type
ligand
sequence L
description binding site for residue HXG C 205
source : AD5

60) chain C
residue 40
type
ligand
sequence D
description binding site for residue HXG C 205
source : AD5

61) chain C
residue 43
type
ligand
sequence D
description binding site for residue HXG C 205
source : AD5

62) chain C
residue 62
type
ligand
sequence H
description binding site for residue HXG C 205
source : AD5

63) chain C
residue 64
type
ligand
sequence N
description binding site for residue HXG C 205
source : AD5

64) chain C
residue 65
type
ligand
sequence N
description binding site for residue HXG C 205
source : AD5

65) chain C
residue 94
type
ligand
sequence A
description binding site for residue HXG C 205
source : AD5

66) chain C
residue 95
type
ligand
sequence N
description binding site for residue HXG C 205
source : AD5

67) chain C
residue 96
type
ligand
sequence Y
description binding site for residue HXG C 205
source : AD5

68) chain A
residue 38
type binding
ligand HXG: 1,2-dihexanoyl-sn-glycero-3-phosphocholine
sequence M
description 1,2-dihexanoyl-sn-glycero-3-phosphocholine binding site
source pdb_hetatom : HXG_6iej_B_204

69) chain B
residue 38-41
type binding
ligand HXG: 1,2-dihexanoyl-sn-glycero-3-phosphocholine
sequence MLDT
description 1,2-dihexanoyl-sn-glycero-3-phosphocholine binding site
source pdb_hetatom : HXG_6iej_B_204

70) chain B
residue 43
type binding
ligand HXG: 1,2-dihexanoyl-sn-glycero-3-phosphocholine
sequence D
description 1,2-dihexanoyl-sn-glycero-3-phosphocholine binding site
source pdb_hetatom : HXG_6iej_B_204

71) chain B
residue 62
type binding
ligand HXG: 1,2-dihexanoyl-sn-glycero-3-phosphocholine
sequence H
description 1,2-dihexanoyl-sn-glycero-3-phosphocholine binding site
source pdb_hetatom : HXG_6iej_B_204

72) chain B
residue 64-65
type binding
ligand HXG: 1,2-dihexanoyl-sn-glycero-3-phosphocholine
sequence NN
description 1,2-dihexanoyl-sn-glycero-3-phosphocholine binding site
source pdb_hetatom : HXG_6iej_B_204

73) chain B
residue 94-96
type binding
ligand HXG: 1,2-dihexanoyl-sn-glycero-3-phosphocholine
sequence ANY
description 1,2-dihexanoyl-sn-glycero-3-phosphocholine binding site
source pdb_hetatom : HXG_6iej_B_204

74) chain A
residue 38-41
type binding
ligand HXG: 1,2-dihexanoyl-sn-glycero-3-phosphocholine
sequence MLDT
description 1,2-dihexanoyl-sn-glycero-3-phosphocholine binding site
source pdb_hetatom : HXG_6iej_A_205

75) chain A
residue 43
type binding
ligand HXG: 1,2-dihexanoyl-sn-glycero-3-phosphocholine
sequence D
description 1,2-dihexanoyl-sn-glycero-3-phosphocholine binding site
source pdb_hetatom : HXG_6iej_A_205

76) chain A
residue 62
type binding
ligand HXG: 1,2-dihexanoyl-sn-glycero-3-phosphocholine
sequence H
description 1,2-dihexanoyl-sn-glycero-3-phosphocholine binding site
source pdb_hetatom : HXG_6iej_A_205

77) chain A
residue 64-65
type binding
ligand HXG: 1,2-dihexanoyl-sn-glycero-3-phosphocholine
sequence NN
description 1,2-dihexanoyl-sn-glycero-3-phosphocholine binding site
source pdb_hetatom : HXG_6iej_A_205

78) chain A
residue 94-96
type binding
ligand HXG: 1,2-dihexanoyl-sn-glycero-3-phosphocholine
sequence ANY
description 1,2-dihexanoyl-sn-glycero-3-phosphocholine binding site
source pdb_hetatom : HXG_6iej_A_205

79) chain B
residue 38
type binding
ligand HXG: 1,2-dihexanoyl-sn-glycero-3-phosphocholine
sequence M
description 1,2-dihexanoyl-sn-glycero-3-phosphocholine binding site
source pdb_hetatom : HXG_6iej_A_205

80) chain B
residue 34
type binding
ligand HXG: 1,2-dihexanoyl-sn-glycero-3-phosphocholine
sequence A
description 1,2-dihexanoyl-sn-glycero-3-phosphocholine binding site
source pdb_hetatom : HXG_6iej_C_205

81) chain C
residue 38-41
type binding
ligand HXG: 1,2-dihexanoyl-sn-glycero-3-phosphocholine
sequence MLDT
description 1,2-dihexanoyl-sn-glycero-3-phosphocholine binding site
source pdb_hetatom : HXG_6iej_C_205

82) chain C
residue 43
type binding
ligand HXG: 1,2-dihexanoyl-sn-glycero-3-phosphocholine
sequence D
description 1,2-dihexanoyl-sn-glycero-3-phosphocholine binding site
source pdb_hetatom : HXG_6iej_C_205

83) chain C
residue 62
type binding
ligand HXG: 1,2-dihexanoyl-sn-glycero-3-phosphocholine
sequence H
description 1,2-dihexanoyl-sn-glycero-3-phosphocholine binding site
source pdb_hetatom : HXG_6iej_C_205

84) chain C
residue 64-65
type binding
ligand HXG: 1,2-dihexanoyl-sn-glycero-3-phosphocholine
sequence NN
description 1,2-dihexanoyl-sn-glycero-3-phosphocholine binding site
source pdb_hetatom : HXG_6iej_C_205

85) chain C
residue 94-96
type binding
ligand HXG: 1,2-dihexanoyl-sn-glycero-3-phosphocholine
sequence ANY
description 1,2-dihexanoyl-sn-glycero-3-phosphocholine binding site
source pdb_hetatom : HXG_6iej_C_205


Display surface

Download
Links