eF-site ID 6idv-B
PDB Code 6idv
Chain B

click to enlarge
Title Peptide Asparaginyl Ligases from Viola yedoensis
Classification LIGASE
Compound Peptide Asparaginyl Ligases
Source (6IDV)
Sequence B:  GTRWAVLIAGSKGYHNYRHQADVCHMYQILRKGGVKDENI
IVFMYDDIAYNESNPFPGIIINKPGGENVYKGVPKDYTGE
DINNVNFLAAILGNKSAIIGGSGKVLDTSPNDHIFIYYAH
GAPGKIGMPSKPYLYADDLVDTLKQKAATGTYKSMVFYVE
ACNAGSMFEGLLPEGTNIYAMAASNSTEGSWITYCPGTPD
FPPEFDVCLGDLWSITFLEDCDAHNLRTETVHQQFELVKK
KIAYASTVSQYGDIPISKDSLSVYMGTDPANDNRTFVDPL
KVIHQHDADLYHIWCKYNMAPEGSSKKIEAQKQLLELMSH
RAHVDNSITLIGKLLFGVNKASKVLNTVRPVGQPLVDDWQ
CLKAMIRTFETHCGSLSEYGMKHTLSFANMCNAGIQKEQL
AEAAAQACVTFPSNPYSSLAEGFSA
Description (1)  Peptide Asparaginyl Ligases


Functional site

1) chain B
residue 145
type
ligand
sequence N
description binding site for residue NAG B 702
source : AC4

2) chain B
residue 129
type
ligand
sequence T
description binding site for residue PEG B 704
source : AC5

3) chain B
residue 132
type
ligand
sequence D
description binding site for residue PEG B 704
source : AC5

4) chain B
residue 153
type
ligand
sequence S
description binding site for Poly-Saccharide residues NAG A 507 through NAG A 508 bound to ASN A 102
source : AC6

5) chain B
residue 64
type
ligand
sequence G
description binding site for Poly-Saccharide residues NAG B 706 through FUC B 708 bound to ASN B 102
source : AC8

6) chain B
residue 65
type
ligand
sequence Y
description binding site for Poly-Saccharide residues NAG B 706 through FUC B 708 bound to ASN B 102
source : AC8

7) chain B
residue 101
type
ligand
sequence Y
description binding site for Poly-Saccharide residues NAG B 706 through FUC B 708 bound to ASN B 102
source : AC8

8) chain B
residue 102
type
ligand
sequence N
description binding site for Poly-Saccharide residues NAG B 706 through FUC B 708 bound to ASN B 102
source : AC8

9) chain B
residue 103
type
ligand
sequence E
description binding site for Poly-Saccharide residues NAG B 706 through FUC B 708 bound to ASN B 102
source : AC8

10) chain B
residue 237
type
ligand
sequence N
description binding site for Mono-Saccharide NAG B 701 bound to ASN B 237
source : AC9

11) chain B
residue 238
type
ligand
sequence S
description binding site for Mono-Saccharide NAG B 701 bound to ASN B 237
source : AC9

12) chain B
residue 239
type
ligand
sequence T
description binding site for Mono-Saccharide NAG B 701 bound to ASN B 237
source : AC9

13) chain B
residue 240
type
ligand
sequence E
description binding site for Mono-Saccharide NAG B 701 bound to ASN B 237
source : AC9

14) chain B
residue 61
type
ligand
sequence G
description binding site for Di-peptide SNN B 703 and HIS B 172
source : AD1

15) chain B
residue 67
type
ligand
sequence N
description binding site for Di-peptide SNN B 703 and HIS B 172
source : AD1

16) chain B
residue 70
type
ligand
sequence H
description binding site for Di-peptide SNN B 703 and HIS B 172
source : AD1

17) chain B
residue 169
type
ligand
sequence Y
description binding site for Di-peptide SNN B 703 and HIS B 172
source : AD1

18) chain B
residue 170
type
ligand
sequence A
description binding site for Di-peptide SNN B 703 and HIS B 172
source : AD1

19) chain B
residue 173
type
ligand
sequence G
description binding site for Di-peptide SNN B 703 and HIS B 172
source : AD1

20) chain B
residue 178
type
ligand
sequence I
description binding site for Di-peptide SNN B 703 and HIS B 172
source : AD1

21) chain B
residue 179
type
ligand
sequence G
description binding site for Di-peptide SNN B 703 and HIS B 172
source : AD1

22) chain B
residue 212
type
ligand
sequence E
description binding site for Di-peptide SNN B 703 and HIS B 172
source : AD1

23) chain B
residue 213
type
ligand
sequence A
description binding site for Di-peptide SNN B 703 and HIS B 172
source : AD1

24) chain B
residue 343
type
ligand
sequence Q
description binding site for Di-peptide SNN B 703 and HIS B 172
source : AD1

25) chain B
residue 436
type
ligand
sequence E
description binding site for Di-peptide SNN B 703 and HIS B 172
source : AD1

26) chain B
residue 59
type
ligand
sequence I
description binding site for Di-peptide SNN B 703 and ALA B 170
source : AD2

27) chain B
residue 60
type
ligand
sequence A
description binding site for Di-peptide SNN B 703 and ALA B 170
source : AD2

28) chain B
residue 61
type
ligand
sequence G
description binding site for Di-peptide SNN B 703 and ALA B 170
source : AD2

29) chain B
residue 70
type
ligand
sequence H
description binding site for Di-peptide SNN B 703 and ALA B 170
source : AD2

30) chain B
residue 168
type
ligand
sequence Y
description binding site for Di-peptide SNN B 703 and ALA B 170
source : AD2

31) chain B
residue 169
type
ligand
sequence Y
description binding site for Di-peptide SNN B 703 and ALA B 170
source : AD2

32) chain B
residue 172
type
ligand
sequence H
description binding site for Di-peptide SNN B 703 and ALA B 170
source : AD2

33) chain B
residue 173
type
ligand
sequence G
description binding site for Di-peptide SNN B 703 and ALA B 170
source : AD2

34) chain B
residue 179
type
ligand
sequence G
description binding site for Di-peptide SNN B 703 and ALA B 170
source : AD2

35) chain B
residue 212
type
ligand
sequence E
description binding site for Di-peptide SNN B 703 and ALA B 170
source : AD2

36) chain B
residue 213
type
ligand
sequence A
description binding site for Di-peptide SNN B 703 and ALA B 170
source : AD2

37) chain B
residue 343
type
ligand
sequence Q
description binding site for Di-peptide SNN B 703 and ALA B 170
source : AD2

38) chain B
residue 146
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence K
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_6idv_A_507

39) chain B
residue 152-154
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence GSG
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_6idv_A_507

40) chain B
residue 129-132
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence TGED
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6idv_B_704

41) chain B
residue 151-152
type binding
ligand PEG: DI(HYDROXYETHYL)ETHER
sequence GG
description DI(HYDROXYETHYL)ETHER binding site
source pdb_hetatom : PEG_6idv_B_704

42) chain B
residue 64-66
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence GYH
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_6idv_B_706

43) chain B
residue 98
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence D
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_6idv_B_706

44) chain B
residue 101-103
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence YNE
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_6idv_B_706

45) chain B
residue 60-62
type binding
ligand SNN: L-3-AMINOSUCCINIMIDE
sequence AGS
description L-3-AMINOSUCCINIMIDE binding site
source pdb_hetatom : SNN_6idv_B_703

46) chain B
residue 70
type binding
ligand SNN: L-3-AMINOSUCCINIMIDE
sequence H
description L-3-AMINOSUCCINIMIDE binding site
source pdb_hetatom : SNN_6idv_B_703

47) chain B
residue 169-170
type binding
ligand SNN: L-3-AMINOSUCCINIMIDE
sequence YA
description L-3-AMINOSUCCINIMIDE binding site
source pdb_hetatom : SNN_6idv_B_703

48) chain B
residue 172-173
type binding
ligand SNN: L-3-AMINOSUCCINIMIDE
sequence HG
description L-3-AMINOSUCCINIMIDE binding site
source pdb_hetatom : SNN_6idv_B_703

49) chain B
residue 179-180
type binding
ligand SNN: L-3-AMINOSUCCINIMIDE
sequence GM
description L-3-AMINOSUCCINIMIDE binding site
source pdb_hetatom : SNN_6idv_B_703

50) chain B
residue 212-214
type binding
ligand SNN: L-3-AMINOSUCCINIMIDE
sequence EAC
description L-3-AMINOSUCCINIMIDE binding site
source pdb_hetatom : SNN_6idv_B_703

51) chain B
residue 242
type binding
ligand SNN: L-3-AMINOSUCCINIMIDE
sequence S
description L-3-AMINOSUCCINIMIDE binding site
source pdb_hetatom : SNN_6idv_B_703

52) chain B
residue 263
type binding
ligand SNN: L-3-AMINOSUCCINIMIDE
sequence D
description L-3-AMINOSUCCINIMIDE binding site
source pdb_hetatom : SNN_6idv_B_703

53) chain B
residue 343
type binding
ligand SNN: L-3-AMINOSUCCINIMIDE
sequence Q
description L-3-AMINOSUCCINIMIDE binding site
source pdb_hetatom : SNN_6idv_B_703

54) chain B
residue 436
type binding
ligand SNN: L-3-AMINOSUCCINIMIDE
sequence E
description L-3-AMINOSUCCINIMIDE binding site
source pdb_hetatom : SNN_6idv_B_703

55) chain B
residue 145
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_6idv_B_702

56) chain B
residue 147-148
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence SA
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_6idv_B_702

57) chain B
residue 221
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence E
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_6idv_B_701

58) chain B
residue 237-240
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence NSTE
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_6idv_B_701

59) chain B
residue 299
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence T
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_6idv_B_701

60) chain B
residue 407
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence R
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_6idv_B_701

61) chain B
residue 409
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence V
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_6idv_B_701

62) chain B
residue 284
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence H
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6idv_B_705

63) chain B
residue 306-307
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence IP
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6idv_B_705

64) chain B
residue 309-310
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence SK
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_6idv_B_705


Display surface

Download
Links