eF-site ID 6iaf-A
PDB Code 6iaf
Chain A

click to enlarge
Title Fifteen minutes iron loaded Rana Catesbeiana H' ferritin variant H54N
Classification OXIDOREDUCTASE
Compound Ferritin, middle subunit
Source (FRI2_LITCT)
Sequence A:  VSQVRQNYHSDCEAAVNRMLNLELYASYTYSSMYAFFDRD
DVALHNVAEFFKENSHEEREHAEKFMKYQNKRGGRVVLQD
IKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKLATDK
VDPHLCDFLESEYLEEQVKDIKRIGDFITNLKRLGLPENG
MGEYLFDKHSVK
Description (1)  Ferritin, middle subunit (E.C.1.16.3.1)


Functional site

1) chain A
residue 169
type
ligand
sequence H
description binding site for residue FE2 A 201
source : AC1

2) chain A
residue 169
type
ligand
sequence H
description binding site for residue FE2 A 201
source : AC1

3) chain A
residue 169
type
ligand
sequence H
description binding site for residue FE2 A 201
source : AC1

4) chain A
residue 169
type
ligand
sequence H
description binding site for residue FE2 A 201
source : AC1

5) chain A
residue 58
type
ligand
sequence E
description binding site for residue FE2 A 202
source : AC2

6) chain A
residue 103
type
ligand
sequence E
description binding site for residue FE2 A 202
source : AC2

7) chain A
residue 137
type
ligand
sequence Q
description binding site for residue FE2 A 202
source : AC2

8) chain A
residue 140
type
ligand
sequence D
description binding site for residue FE2 A 202
source : AC2

9) chain A
residue 23
type
ligand
sequence E
description binding site for residue FE2 A 203
source : AC3

10) chain A
residue 58
type
ligand
sequence E
description binding site for residue FE2 A 203
source : AC3

11) chain A
residue 61
type
ligand
sequence H
description binding site for residue FE2 A 203
source : AC3

12) chain A
residue 57
type
ligand
sequence E
description binding site for residue FE2 A 204
source : AC4

13) chain A
residue 136
type
ligand
sequence E
description binding site for residue FE2 A 204
source : AC4

14) chain A
residue 140
type
ligand
sequence D
description binding site for residue FE2 A 204
source : AC4

15) chain A
residue 127
type
ligand
sequence D
description binding site for residue FE2 A 206
source : AC6

16) chain A
residue 127
type
ligand
sequence D
description binding site for residue FE2 A 206
source : AC6

17) chain A
residue 135
type
ligand
sequence E
description binding site for residue MG A 207
source : AC7

18) chain A
residue 45
type
ligand
sequence H
description binding site for residue MG A 210
source : AD1

19) chain A
residue 10
type
ligand
sequence S
description binding site for residue MG A 213
source : AD4

20) chain A
residue 7
type
ligand
sequence N
description binding site for residue CL A 214
source : AD5

21) chain A
residue 108
type
ligand
sequence Q
description binding site for residue CL A 214
source : AD5

22) chain A
residue 10
type
ligand
sequence S
description binding site for residue CL A 215
source : AD6

23) chain A
residue 165
type
ligand
sequence L
description binding site for residue CL A 216
source : AD7

24) chain A
residue 165
type
ligand
sequence L
description binding site for residue CL A 216
source : AD7

25) chain A
residue 165
type
ligand
sequence L
description binding site for residue CL A 216
source : AD7

26) chain A
residue 165
type
ligand
sequence L
description binding site for residue CL A 216
source : AD7

27) chain A
residue 169
type
ligand
sequence H
description binding site for residue CL A 216
source : AD7

28) chain A
residue 169
type
ligand
sequence H
description binding site for residue CL A 216
source : AD7

29) chain A
residue 169
type
ligand
sequence H
description binding site for residue CL A 216
source : AD7

30) chain A
residue 169
type
ligand
sequence H
description binding site for residue CL A 216
source : AD7

31) chain A
residue 5
type
ligand
sequence R
description binding site for residue CL A 217
source : AD8

32) chain A
residue 7
type
ligand
sequence N
description binding site for residue CL A 217
source : AD8

33) chain A
residue 8
type
ligand
sequence Y
description binding site for residue CL A 217
source : AD8

34) chain A
residue 87
type
ligand
sequence D
description binding site for residue CL A 218
source : AD9

35) chain A
residue 88
type
ligand
sequence E
description binding site for residue CL A 218
source : AD9

36) chain A
residue 82
type
ligand
sequence K
description binding site for residue CL A 219
source : AE1

37) chain A
residue 82
type
ligand
sequence K
description binding site for residue CL A 219
source : AE1

38) chain A
residue 101
type
ligand
sequence Q
description binding site for residue CL A 221
source : AE3

39) chain A
residue 102
type
ligand
sequence L
description binding site for residue CL A 221
source : AE3

40) chain A
residue 105
type
ligand
sequence T
description binding site for residue CL A 221
source : AE3

41) chain A
residue 17
type
ligand
sequence N
description binding site for residue CL A 222
source : AE4


Display surface

Download
Links