eF-site ID 6i9e-F
PDB Code 6i9e
Chain F

click to enlarge
Title Thermophage P23-45 empty expanded capsid
Classification VIRUS
Compound Major head protein
Source ORGANISM_SCIENTIFIC: Thermus virus P23-45;
Sequence F:  MRVPININNALARVRDPLSIGGLKFPTTKEIQEAVAAIAD
KFNQENDLVDRFFPEDSTFASELELYLLRTQDAEQTGMTF
VHQVGSTSLPVEARVAKVDLAKATWSPLAFKESRVWDEKE
ILYLGRLADEVQAGVINEQIAESLTWLMARMRNRRRWLTW
QVMRTGRITIQPNDPYNPNGLKYVIDYGVTDIELPLPQKF
DAKDGNGNSAVDPIQYFRDLIKAATYFPDRRPVAIIVGPG
FDEVLADNTFVQKYVEYEKGWVVGQNTVQPPREVYRQAAL
DIFKRYTGLEVMVYDKTYRDQDGSVKYWIPVGELIVLNQS
TGPVGRFVYTAHVAGQRNGKVVYATGPYLTVKDHLQDDPP
YYAIIAGFHGLPQLSGYNTEDFSFHRFKWLKYANNVQSYL
PPFPPKVEL
Description (1)  Major head protein, Auxiliary protein

Display surface

Download
Links