eF-site ID 6i3y-F
PDB Code 6i3y
Chain F

click to enlarge
Title Crystal structure of the human mitochondrial PRELID1K58V-TRIAP1 complex with PS
Classification LIPID TRANSPORT
Compound PRELI domain-containing protein 1, mitochondrial
Source (TRIA1_HUMAN)
Sequence F:  SHHHHHHSDQMVKYFLGQSVLRSSWDQVFAAFWQRYPNPY
SKHVLTEDIVHREVTPDQKLLSRRLLTVTNRMPRWAERLF
PANVAHSVYVLEDSIVDPQNQTMTTFTWNINHARLMVVEE
RSVYSVNSDNSGWTEIRREAWVSSSLFGVSRAVQEFGLAR
FKSNVTKTMKGFEYILAKLQGE
Description (1)  PRELI domain-containing protein 1, mitochondrial, TP53-regulated inhibitor of apoptosis 1


Functional site

1) chain F
residue 161
type
ligand
sequence R
description binding site for residue P5S C 202
source : AC2

2) chain F
residue 36
type
ligand
sequence R
description binding site for residue P5S F 201
source : AC3

3) chain F
residue 37
type
ligand
sequence Y
description binding site for residue P5S F 201
source : AC3

4) chain F
residue 39
type
ligand
sequence N
description binding site for residue P5S F 201
source : AC3

5) chain F
residue 41
type
ligand
sequence Y
description binding site for residue P5S F 201
source : AC3

6) chain F
residue 42
type
ligand
sequence S
description binding site for residue P5S F 201
source : AC3

7) chain F
residue 44
type
ligand
sequence H
description binding site for residue P5S F 201
source : AC3

8) chain F
residue 69
type
ligand
sequence V
description binding site for residue P5S F 201
source : AC3

9) chain F
residue 70
type
ligand
sequence T
description binding site for residue P5S F 201
source : AC3

10) chain F
residue 71
type
ligand
sequence N
description binding site for residue P5S F 201
source : AC3

11) chain F
residue 72
type
ligand
sequence R
description binding site for residue P5S F 201
source : AC3

12) chain F
residue 73
type
ligand
sequence M
description binding site for residue P5S F 201
source : AC3

13) chain F
residue 89
type
ligand
sequence V
description binding site for residue P5S F 201
source : AC3

14) chain F
residue 91
type
ligand
sequence V
description binding site for residue P5S F 201
source : AC3

15) chain F
residue 110
type
ligand
sequence N
description binding site for residue P5S F 201
source : AC3

16) chain F
residue 113
type
ligand
sequence H
description binding site for residue P5S F 201
source : AC3

17) chain F
residue 117
type
ligand
sequence M
description binding site for residue P5S F 201
source : AC3

18) chain F
residue 119
type
ligand
sequence V
description binding site for residue P5S F 201
source : AC3

19) chain F
residue 36-37
type binding
ligand P5S: O-[(R)-{[(2R)-2,3-bis(octadecanoyloxy)propyl]oxy}(hydroxy)phosphoryl]-L-serine
sequence RY
description O-[(R)-{[(2R)-2,3-bis(octadecanoyloxy)propyl]oxy}(hydroxy)phosphoryl]-L-serine binding site
source pdb_hetatom : P5S_6i3y_F_201

20) chain F
residue 39
type binding
ligand P5S: O-[(R)-{[(2R)-2,3-bis(octadecanoyloxy)propyl]oxy}(hydroxy)phosphoryl]-L-serine
sequence N
description O-[(R)-{[(2R)-2,3-bis(octadecanoyloxy)propyl]oxy}(hydroxy)phosphoryl]-L-serine binding site
source pdb_hetatom : P5S_6i3y_F_201

21) chain F
residue 41-42
type binding
ligand P5S: O-[(R)-{[(2R)-2,3-bis(octadecanoyloxy)propyl]oxy}(hydroxy)phosphoryl]-L-serine
sequence YS
description O-[(R)-{[(2R)-2,3-bis(octadecanoyloxy)propyl]oxy}(hydroxy)phosphoryl]-L-serine binding site
source pdb_hetatom : P5S_6i3y_F_201

22) chain F
residue 44-45
type binding
ligand P5S: O-[(R)-{[(2R)-2,3-bis(octadecanoyloxy)propyl]oxy}(hydroxy)phosphoryl]-L-serine
sequence HV
description O-[(R)-{[(2R)-2,3-bis(octadecanoyloxy)propyl]oxy}(hydroxy)phosphoryl]-L-serine binding site
source pdb_hetatom : P5S_6i3y_F_201

23) chain F
residue 67
type binding
ligand P5S: O-[(R)-{[(2R)-2,3-bis(octadecanoyloxy)propyl]oxy}(hydroxy)phosphoryl]-L-serine
sequence L
description O-[(R)-{[(2R)-2,3-bis(octadecanoyloxy)propyl]oxy}(hydroxy)phosphoryl]-L-serine binding site
source pdb_hetatom : P5S_6i3y_F_201

24) chain F
residue 69-73
type binding
ligand P5S: O-[(R)-{[(2R)-2,3-bis(octadecanoyloxy)propyl]oxy}(hydroxy)phosphoryl]-L-serine
sequence VTNRM
description O-[(R)-{[(2R)-2,3-bis(octadecanoyloxy)propyl]oxy}(hydroxy)phosphoryl]-L-serine binding site
source pdb_hetatom : P5S_6i3y_F_201

25) chain F
residue 89
type binding
ligand P5S: O-[(R)-{[(2R)-2,3-bis(octadecanoyloxy)propyl]oxy}(hydroxy)phosphoryl]-L-serine
sequence V
description O-[(R)-{[(2R)-2,3-bis(octadecanoyloxy)propyl]oxy}(hydroxy)phosphoryl]-L-serine binding site
source pdb_hetatom : P5S_6i3y_F_201

26) chain F
residue 91
type binding
ligand P5S: O-[(R)-{[(2R)-2,3-bis(octadecanoyloxy)propyl]oxy}(hydroxy)phosphoryl]-L-serine
sequence V
description O-[(R)-{[(2R)-2,3-bis(octadecanoyloxy)propyl]oxy}(hydroxy)phosphoryl]-L-serine binding site
source pdb_hetatom : P5S_6i3y_F_201

27) chain F
residue 108-110
type binding
ligand P5S: O-[(R)-{[(2R)-2,3-bis(octadecanoyloxy)propyl]oxy}(hydroxy)phosphoryl]-L-serine
sequence TWN
description O-[(R)-{[(2R)-2,3-bis(octadecanoyloxy)propyl]oxy}(hydroxy)phosphoryl]-L-serine binding site
source pdb_hetatom : P5S_6i3y_F_201

28) chain F
residue 113
type binding
ligand P5S: O-[(R)-{[(2R)-2,3-bis(octadecanoyloxy)propyl]oxy}(hydroxy)phosphoryl]-L-serine
sequence H
description O-[(R)-{[(2R)-2,3-bis(octadecanoyloxy)propyl]oxy}(hydroxy)phosphoryl]-L-serine binding site
source pdb_hetatom : P5S_6i3y_F_201

29) chain F
residue 116-117
type binding
ligand P5S: O-[(R)-{[(2R)-2,3-bis(octadecanoyloxy)propyl]oxy}(hydroxy)phosphoryl]-L-serine
sequence LM
description O-[(R)-{[(2R)-2,3-bis(octadecanoyloxy)propyl]oxy}(hydroxy)phosphoryl]-L-serine binding site
source pdb_hetatom : P5S_6i3y_F_201

30) chain F
residue 119-121
type binding
ligand P5S: O-[(R)-{[(2R)-2,3-bis(octadecanoyloxy)propyl]oxy}(hydroxy)phosphoryl]-L-serine
sequence VEE
description O-[(R)-{[(2R)-2,3-bis(octadecanoyloxy)propyl]oxy}(hydroxy)phosphoryl]-L-serine binding site
source pdb_hetatom : P5S_6i3y_F_201


Display surface

Download
Links