eF-site ID 6i2q-A PDB Code 6i2q Chain A click to enlarge Title Crystal structure of the wild-type SucA domain of Mycobacterium smegmatis KGD (alpha-ketoglutarate decarboxylase), in complex with GarA Classification OXIDOREDUCTASE Compound Multifunctional 2-oxoglutarate metabolism enzyme Source (GARA_MYCS2) Sequence A:  DSIEDKNARVIELIAAYRNRGHLMADIDPLRLDNTRFSHG LTLWDLDREFKVVQRKKLRDILSVLRDAYCRHVGVEYTHI LEPEQQRWIQERVETKHDKPTVAEQKYILSKLNAAEAFET FLQTKYVGQKRFSLEGAETVIPMMDAVIDQCAEHGLDEVV IAMPHRGRLNVLANIVGKPYSQIFSEFGDVKYHLGATGTY IQMFGDNDIEVSLTANPSHLEAVDPVLEGLVRAKQDLLDT GEEGSDNRFSVVPLMLHGDAAFAGQGVVAETLNLALLRGY RTGGTIHIVVNNQIGFTTAPTDSRSSEYCTDVAKMIGAPI FHVNGDDPEACAWVARLAVDFRQAFKKDVVIDMLCYRRRG HNEGDDPSMTQPYMYDVIDTKRGSRKAYTEALIGRGDISM KEAEDALRDYQGQLERVFNEVRELEKHLATAVDKAMLQRI GDAHLALPEGFTVHPRVRPVLEKRREMAYEGRIDWAFAEL LALGSLIAEGKLVRLSGQDTQRGTFTQRHAVIVDRKTGEE FTPLQLLATNPDGTPTGGKFLVYNSALSEFAAVGFEYGYS VGNPDAMVLWEAQFGDFVNGAQSIIDEFISSGEAKWGQLS DVVLLLPHGHEGQGPDHTSGRIERFLQLWAEGSMTIAMPS TPANYFHLLRRHGKDGIQRPLIVFTPKSMLRNKAAVSDIR DFTESKFRSVLEEPMYTDGEGDRNKVTRLLLTSGKIYYEL AARKAKENREDVAIVRIEQLAPLPRRRLAETLDRYPNVKE KFWVQEEPANQGAWPSFGLTLPEILPDHFTGLKRISRRAM SAPSSGSSKVHAVEQQEILDTAFG Description Functional site 1) chain A residue 540 type sequence R description binding site for residue TPP A 2001 source : AC1 2) chain A residue 604 type sequence S description binding site for residue TPP A 2001 source : AC1 3) chain A residue 605 type sequence H description binding site for residue TPP A 2001 source : AC1 4) chain A residue 606 type sequence L description binding site for residue TPP A 2001 source : AC1 5) chain A residue 644 type sequence G description binding site for residue TPP A 2001 source : AC1 6) chain A residue 645 type sequence D description binding site for residue TPP A 2001 source : AC1 7) chain A residue 646 type sequence A description binding site for residue TPP A 2001 source : AC1 8) chain A residue 647 type sequence A description binding site for residue TPP A 2001 source : AC1 9) chain A residue 651 type sequence Q description binding site for residue TPP A 2001 source : AC1 10) chain A residue 678 type sequence N description binding site for residue TPP A 2001 source : AC1 11) chain A residue 680 type sequence I description binding site for residue TPP A 2001 source : AC1 12) chain A residue 681 type sequence G description binding site for residue TPP A 2001 source : AC1 13) chain A residue 747 type sequence H description binding site for residue TPP A 2001 source : AC1 14) chain A residue 901 type sequence Q description binding site for residue TPP A 2001 source : AC1 15) chain A residue 950 type sequence L description binding site for residue TPP A 2001 source : AC1 16) chain A residue 952 type sequence E description binding site for residue TPP A 2001 source : AC1 17) chain A residue 976 type sequence Q description binding site for residue TPP A 2001 source : AC1 18) chain A residue 980 type sequence F description binding site for residue TPP A 2001 source : AC1 19) chain A residue 645 type sequence D description binding site for residue MG A 2002 source : AC2 20) chain A residue 678 type sequence N description binding site for residue MG A 2002 source : AC2 21) chain A residue 680 type sequence I description binding site for residue MG A 2002 source : AC2 22) chain A residue 1004 type sequence D description binding site for residue CA A 2003 source : AC3 23) chain A residue 1055 type sequence H description binding site for residue CA A 2003 source : AC3 24) chain A residue 1058 type sequence D description binding site for residue CA A 2003 source : AC3 25) chain A residue 1060 type sequence I description binding site for residue CA A 2003 source : AC3 26) chain A residue 1054 type BINDING sequence R description BINDING => ECO:0000269|PubMed:21867916, ECO:0007744|PDB:2XTA source Swiss-Prot : SWS_FT_FI1 27) chain A residue 1089 type BINDING sequence K description BINDING => ECO:0000269|PubMed:21867916, ECO:0007744|PDB:2XTA source Swiss-Prot : SWS_FT_FI1 28) chain A residue 1092 type BINDING sequence S description BINDING => ECO:0000269|PubMed:21867916, ECO:0007744|PDB:2XTA source Swiss-Prot : SWS_FT_FI1 29) chain A residue 1142 type BINDING sequence Q description BINDING => ECO:0000269|PubMed:21867916, ECO:0007744|PDB:2XTA source Swiss-Prot : SWS_FT_FI1 30) chain A residue 1149 type BINDING sequence R description BINDING => ECO:0000269|PubMed:21867916, ECO:0007744|PDB:2XTA source Swiss-Prot : SWS_FT_FI1 31) chain A residue 1150 type BINDING sequence R description BINDING => ECO:0000269|PubMed:21867916, ECO:0007744|PDB:2XTA source Swiss-Prot : SWS_FT_FI1 32) chain A residue 1038 type BINDING sequence T description BINDING => ECO:0000269|PubMed:21867916, ECO:0007744|PDB:2XTA source Swiss-Prot : SWS_FT_FI1 33) chain A residue 606 type BINDING sequence L description BINDING => ECO:0000269|PubMed:21867916, ECO:0007744|PDB:2XTA source Swiss-Prot : SWS_FT_FI1 34) chain A residue 645 type BINDING sequence D description BINDING => ECO:0000269|PubMed:21867916, ECO:0007744|PDB:2XTA source Swiss-Prot : SWS_FT_FI1 35) chain A residue 646 type BINDING sequence A description BINDING => ECO:0000269|PubMed:21867916, ECO:0007744|PDB:2XTA source Swiss-Prot : SWS_FT_FI1 36) chain A residue 647 type BINDING sequence A description BINDING => ECO:0000269|PubMed:21867916, ECO:0007744|PDB:2XTA source Swiss-Prot : SWS_FT_FI1 37) chain A residue 678 type BINDING sequence N description BINDING => ECO:0000269|PubMed:21867916, ECO:0007744|PDB:2XTA source Swiss-Prot : SWS_FT_FI1 38) chain A residue 680 type BINDING sequence I description BINDING => ECO:0000269|PubMed:21867916, ECO:0007744|PDB:2XTA source Swiss-Prot : SWS_FT_FI1 39) chain A residue 540 type BINDING sequence R description BINDING => ECO:0000269|PubMed:21867916, ECO:0007744|PDB:2XTA source Swiss-Prot : SWS_FT_FI1 40) chain A residue 604 type BINDING sequence S description BINDING => ECO:0000269|PubMed:21867916, ECO:0007744|PDB:2XTA source Swiss-Prot : SWS_FT_FI1 41) chain A residue 1020 type BINDING sequence H description BINDING => ECO:0000305|PubMed:21867916, ECO:0007744|PDB:2Y0P source Swiss-Prot : SWS_FT_FI2 42) chain A residue 579 type BINDING sequence H description BINDING => ECO:0000305|PubMed:21867916, ECO:0007744|PDB:2Y0P source Swiss-Prot : SWS_FT_FI2

Display surface Download Links