eF-site ID 6hxe-A PDB Code 6hxe Chain A click to enlarge Title Crystal structure of psychrophilic phosphoglycerate kinase from Pseudomonas TACII18 in complex with 3-phosphoglycerate Classification TRANSFERASE Compound Phosphoglycerate kinase Source (Q9RBS3_9PSED) Sequence A:  TVLKMTDLDLQGKRVLIREDLNVPVKDGVVTSDARILASL PTIKLALEKGAAVMVCSHLGRPTEGEFSAENSLKPVADYL SKALGREVPLVSDYLNGVDVKAGDIVLFENVRFNKGEKKN ADELAKQYAALCDVFVMDAFGTAHRAEGSTHGVAKFAKVA AAGPLLAAELDALGKALGAPAKPMAAIVAGSKVSTKLDVL NSLSQICDLLIVGGGIADTFLAAAGHPVGKSLYEPDLLDT ARAIAAKVNVPLPTDVVVAKEFAESAEATVKLIADVAADD MILDIGPQTAEHFAQLLKTSKTILWNGPVGVFEFDQFGNG TKVLAKAIADSAAFSIAGGGDTLAAIDKYGVADQISQIST GGGAFLEFVEGKVLPAVEVLESRAKA Description Functional site 1) chain A residue 88 type sequence E description binding site for residue 3PG A 4000 source : AC1 2) chain A residue 121 type sequence N description binding site for residue 3PG A 4000 source : AC1 3) chain A residue 123 type sequence D description binding site for residue 3PG A 4000 source : AC1 4) chain A residue 152 type sequence H description binding site for residue 3PG A 4000 source : AC1 5) chain A residue 156 type sequence K description binding site for residue 3PG A 4000 source : AC1 6) chain A residue 264 type sequence A description binding site for residue 3PG A 4000 source : AC1 7) chain A residue 265 type sequence E description binding site for residue 3PG A 4000 source : AC1 8) chain A residue 267 type sequence A description binding site for residue 3PG A 4000 source : AC1 9) chain A residue 15-25 type prosite sequence RVLIREDLNVP description PGLYCERATE_KINASE Phosphoglycerate kinase signature. RVLIReDlNVP source prosite : PS00111

Display surface Download Links