eF-site ID 6hwd-K PDB Code 6hwd Chain K click to enlarge Title Yeast 20S proteasome beta2-G45A mutant in complex with bortezomib Classification HYDROLASE Compound Proteasome subunit alpha type-2 Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae S288c; Sequence K:  TTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPF LLGTMAGGAADCQFWETWLGSQCRLHELREKERISVAAAS KILSNLVYQYKGAGLSMGTMICGYTRKEGPTIYYVDSDGT RLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRS ILAAAHRDAYSGGSVNLYHVTEDGWIYHGNHDVGELFWKV KEEEGSFNNVIG Description Functional site 1) chain K residue 1 type sequence T description binding site for residue BO2 K 301 source : AC6 2) chain K residue 20 type sequence A description binding site for residue BO2 K 301 source : AC6 3) chain K residue 21 type sequence T description binding site for residue BO2 K 301 source : AC6 4) chain K residue 27 type sequence A description binding site for residue BO2 K 301 source : AC6 5) chain K residue 47 type sequence G description binding site for residue BO2 K 301 source : AC6 6) chain K residue 49 type sequence A description binding site for residue BO2 K 301 source : AC6 7) chain K residue 165 type sequence A description binding site for residue MG K 302 source : AC7 8) chain K residue 166 type sequence H description binding site for residue MG K 302 source : AC7 9) chain K residue 168 type sequence D description binding site for residue MG K 302 source : AC7 10) chain K residue 169 type sequence A description binding site for residue MG K 302 source : AC7 11) chain K residue 171 type sequence S description binding site for residue MG K 302 source : AC7 12) chain K residue 49 type BINDING sequence A description source Swiss-Prot : SWS_FT_FI2 13) chain K residue 4-51 type prosite sequence LAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLG TMAGGAAD description PROTEASOME_BETA_1 Proteasome beta-type subunits signature. ISMkYdnGVIIAADnlgsygsllrfngve.RlipvgdntvvgisGdiSD source prosite : PS00854

Display surface Download Links