eF-site ID 6hw5-V PDB Code 6hw5 Chain V click to enlarge Title Yeast 20S proteasome in complex with 18 Classification HYDROLASE Compound Proteasome subunit alpha type-2 Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae (strain ATCC 204508 / S288c); Sequence V:  TTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPK IWCAGAGTAADTEAVTQLIGSNIELHSLYTSREPRVVSAL QMLKQHLFKYQGHIGAYLIVAGVDPTGSHLFSIHAHGSTD VGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQ AGIWNDLGSGSNVDVCVMEIGKDAEYLRNYLTPNVREEKQ KSYKFPRGTTAVLKESIVNICD Description Functional site 1) chain V residue 163 type sequence I description binding site for residue MG L 301 source : AC8 2) chain V residue 166 type sequence D description binding site for residue MG L 301 source : AC8 3) chain V residue 169 type sequence S description binding site for residue MG L 301 source : AC8 4) chain V residue 69 type sequence Y description binding site for residue CL U 301 source : AD1 5) chain V residue 2 type sequence T description binding site for Di-peptide GRT V 301 and THR V 1 source : AD4 6) chain V residue 3 type sequence I description binding site for Di-peptide GRT V 301 and THR V 1 source : AD4 7) chain V residue 17 type sequence D description binding site for Di-peptide GRT V 301 and THR V 1 source : AD4 8) chain V residue 21 type sequence T description binding site for Di-peptide GRT V 301 and THR V 1 source : AD4 9) chain V residue 22 type sequence Q description binding site for Di-peptide GRT V 301 and THR V 1 source : AD4 10) chain V residue 27 type sequence A description binding site for Di-peptide GRT V 301 and THR V 1 source : AD4 11) chain V residue 31 type sequence C description binding site for Di-peptide GRT V 301 and THR V 1 source : AD4 12) chain V residue 33 type sequence K description binding site for Di-peptide GRT V 301 and THR V 1 source : AD4 13) chain V residue 45 type sequence G description binding site for Di-peptide GRT V 301 and THR V 1 source : AD4 14) chain V residue 47 type sequence G description binding site for Di-peptide GRT V 301 and THR V 1 source : AD4 15) chain V residue 49 type sequence A description binding site for Di-peptide GRT V 301 and THR V 1 source : AD4 16) chain V residue 53 type sequence E description binding site for Di-peptide GRT V 301 and THR V 1 source : AD4 17) chain V residue 128 type sequence G description binding site for Di-peptide GRT V 301 and THR V 1 source : AD4 18) chain V residue 129 type sequence S description binding site for Di-peptide GRT V 301 and THR V 1 source : AD4 19) chain V residue 130 type sequence G description binding site for Di-peptide GRT V 301 and THR V 1 source : AD4 20) chain V residue 168 type sequence G description binding site for Di-peptide GRT V 301 and THR V 1 source : AD4 21) chain V residue 169 type sequence S description binding site for Di-peptide GRT V 301 and THR V 1 source : AD4 22) chain V residue 1 type catalytic sequence T description 177 source MCSA : MCSA2 23) chain V residue 17 type catalytic sequence D description 177 source MCSA : MCSA2 24) chain V residue 19 type catalytic sequence R description 177 source MCSA : MCSA2 25) chain V residue 33 type catalytic sequence K description 177 source MCSA : MCSA2 26) chain V residue 47 type catalytic sequence G description 177 source MCSA : MCSA2 27) chain V residue 129 type catalytic sequence S description 177 source MCSA : MCSA2 28) chain V residue 166 type catalytic sequence D description 177 source MCSA : MCSA2 29) chain V residue 169 type catalytic sequence S description 177 source MCSA : MCSA2

Display surface Download Links