eF-site ID 6hvv-W PDB Code 6hvv Chain W click to enlarge Title Yeast 20S proteasome with human beta2i (1-53) in complex with 39 Classification HYDROLASE Compound Proteasome subunit alpha type-2 Source ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae S288C; Sequence W:  SDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFE KIFHYGHVFLGITGLATDVTTLNEMFRYKTNLYKLKEERA IEPETFTQLVSSSLYERRFGPYFVGPVVAGINSKSGKPFI AGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPE DLFETISQALLNAADRDALSGWGAVVYIIKKDEVVKRYLK MRQD Description Functional site 1) chain W residue 204 type sequence D description binding site for residue MG K 302 source : AC7 2) chain W residue 174 type sequence A description binding site for residue MG W 301 source : AD3 3) chain W residue 177 type sequence D description binding site for residue MG W 301 source : AD3 4) chain W residue 180 type sequence S description binding site for residue MG W 301 source : AD3 5) chain W residue 204 type sequence D description binding site for residue MG W 301 source : AD3 6) chain W residue 124 type sequence D description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD6 7) chain W residue 125 type sequence L description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD6 8) chain W residue 124 type sequence D description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD7 9) chain W residue 125 type sequence L description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD7 10) chain W residue 69 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2

Display surface Download Links