eF-site ID 6hvv-V PDB Code 6hvv Chain V click to enlarge Title Yeast 20S proteasome with human beta2i (1-53) in complex with 39 Classification HYDROLASE Compound Proteasome subunit alpha type-2 Source ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae S288C; Sequence V:  TTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPK IYCCGAGVAADAEAVTQLIGSNIELHSLYTSREPRVVSAL QMLKQHLFKYQGHIGAYLIVAGVDPTGSHLFSIHAHGSTD VGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQ AGIWNDLGSGSNVDVCVMEIGKDAEYLRNYLTPNVREEKQ KSYKFPRGTTAVLKESIVNICDI Description Functional site 1) chain V residue 69 type sequence Y description binding site for residue CL U 301 source : AC9 2) chain V residue 163 type sequence I description binding site for residue MG V 302 source : AD1 3) chain V residue 164 type sequence W description binding site for residue MG V 302 source : AD1 4) chain V residue 166 type sequence D description binding site for residue MG V 302 source : AD1 5) chain V residue 169 type sequence S description binding site for residue MG V 302 source : AD1 6) chain V residue 47 type sequence G description binding site for residue MES V 303 source : AD2 7) chain V residue 129 type sequence S description binding site for residue MES V 303 source : AD2 8) chain V residue 2 type sequence T description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD6 9) chain V residue 3 type sequence I description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD6 10) chain V residue 17 type sequence D description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD6 11) chain V residue 20 type sequence A description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD6 12) chain V residue 21 type sequence T description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD6 13) chain V residue 22 type sequence N description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD6 14) chain V residue 33 type sequence K description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD6 15) chain V residue 35 type sequence H description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD6 16) chain V residue 45 type sequence G description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD6 17) chain V residue 46 type sequence A description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD6 18) chain V residue 47 type sequence G description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD6 19) chain V residue 48 type sequence V description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD6 20) chain V residue 49 type sequence A description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD6 21) chain V residue 128 type sequence G description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD6 22) chain V residue 129 type sequence S description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD6 23) chain V residue 130 type sequence G description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD6 24) chain V residue 168 type sequence G description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD6 25) chain V residue 169 type sequence S description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD6 26) chain V residue 2 type sequence T description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD7 27) chain V residue 3 type sequence I description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD7 28) chain V residue 17 type sequence D description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD7 29) chain V residue 20 type sequence A description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD7 30) chain V residue 21 type sequence T description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD7 31) chain V residue 22 type sequence N description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD7 32) chain V residue 33 type sequence K description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD7 33) chain V residue 35 type sequence H description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD7 34) chain V residue 45 type sequence G description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD7 35) chain V residue 46 type sequence A description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD7 36) chain V residue 47 type sequence G description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD7 37) chain V residue 48 type sequence V description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD7 38) chain V residue 49 type sequence A description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD7 39) chain V residue 128 type sequence G description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD7 40) chain V residue 129 type sequence S description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD7 41) chain V residue 130 type sequence G description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD7 42) chain V residue 168 type sequence G description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD7 43) chain V residue 169 type sequence S description binding site for Di-peptide GT8 V 301 and THR V 1 source : AD7 44) chain V residue 169 type catalytic sequence S description 177 source MCSA : MCSA2 45) chain V residue 129 type catalytic sequence S description 177 source MCSA : MCSA2 46) chain V residue 166 type catalytic sequence D description 177 source MCSA : MCSA2 47) chain V residue 1 type catalytic sequence T description 177 source MCSA : MCSA2

Display surface Download Links