eF-site ID 6hvv-I PDB Code 6hvv Chain I click to enlarge Title Yeast 20S proteasome with human beta2i (1-53) in complex with 39 Classification HYDROLASE Compound Proteasome subunit alpha type-2 Source ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae S288C; Sequence I:  SDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFE KIFHYGHVFLGITGLATDVTTLNEMFRYKTNLYKLKEERA IEPETFTQLVSSSLYERRFGPYFVGPVVAGINSKSGKPFI AGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPE DLFETISQALLNAADRDALSGWGAVVYIIKKDEVVKRYLK MRQD Description Functional site 1) chain I residue 124 type sequence D description binding site for residue GT8 H 301 source : AC3 2) chain I residue 125 type sequence L description binding site for residue GT8 H 301 source : AC3 3) chain I residue 174 type sequence A description binding site for residue MG I 301 source : AC5 4) chain I residue 177 type sequence D description binding site for residue MG I 301 source : AC5 5) chain I residue 180 type sequence S description binding site for residue MG I 301 source : AC5 6) chain I residue 204 type sequence D description binding site for residue MG I 301 source : AC5 7) chain I residue 204 type sequence D description binding site for residue MG Y 302 source : AD4 8) chain I residue 12-58 type prosite sequence VAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFHYGHVFLG ITGLATD description PROTEASOME_BETA_1 Proteasome beta-type subunits signature. ISMkYdnGVIIAADnlgsygsllrfngve.RlipvgdntvvgisGdiSD source prosite : PS00854

Display surface Download Links