eF-site ID 6hvu-a
PDB Code 6hvu
Chain a

click to enlarge
Title Yeast 20S proteasome with human beta2i (1-53) in complex with 29
Classification HYDROLASE
Compound Proteasome subunit alpha type-2
Source ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae S288C;
Sequence a:  TQQPIVTGTSVISMKYDNGVIIAADNLGSYGSLLRFNGVE
RLIPVGDNTVVGISGDISDMQHIERLLKDLVTENAYDNPL
ADAEEALEPSYIFEYLATVMYQRRSKMNPLWNAIIVAGVQ
SNGDQFLRYVNLLGVTYSSPTLATGFGAHMANPLLRKVVD
RESDIPKTTVQVAEEAIVNAMRVLYYRDARSSRNFSLAII
DKNTGLTFKKNLQVENMKWDFAKDIKGYGTQKI
Description (1)  Proteasome subunit alpha type-2 (E.C.3.4.25.1), Proteasome subunit alpha type-3 (E.C.3.4.25.1), Proteasome subunit alpha type-4 (E.C.3.4.25.1), Proteasome subunit alpha type-5 (E.C.3.4.25.1), Proteasome subunit alpha type-6 (E.C.3.4.25.1), Probable proteasome subunit alpha type-7 (E.C.3.4.25.1), Proteasome subunit alpha type-1 (E.C.3.4.25.1), Proteasome subunit beta type-7 (E.C.3.4.25.1), Proteasome subunit beta type-3 (E.C.3.4.25.1), Proteasome subunit beta type-4 (E.C.3.4.25.1), Proteasome subunit beta type-5 (E.C.3.4.25.1), Proteasome subunit beta type-6 (E.C.3.4.25.1), Proteasome subunit beta type-1 (E.C.3.4.25.1)


Functional site

1) chain a
residue 34
type
ligand
sequence L
description binding site for residue MG N 201
source : AC7


Display surface

Download
Links