eF-site ID 6hvu-L
PDB Code 6hvu
Chain L

click to enlarge
Title Yeast 20S proteasome with human beta2i (1-53) in complex with 29
Classification HYDROLASE
Compound Proteasome subunit alpha type-2
Source ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae S288C;
Sequence L:  QFNPYGDNGGTILGIAGEDFAVLAGDTRNITDYSINSRYE
PKVFDCGDNIVMSANGFAADGDALVKRFKNSVKWYHFDHN
DKKLSINSAARNIQHLLYGKRFFPYYVHTIIAGLDEDGKG
AVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQY
EPGTNGKVKKPLKYLSVEEVIKLVRDSFTSATERHIQVGD
GLEILIVTKDGVRKEFYELKRD
Description (1)  Proteasome subunit alpha type-2 (E.C.3.4.25.1), Proteasome subunit alpha type-3 (E.C.3.4.25.1), Proteasome subunit alpha type-4 (E.C.3.4.25.1), Proteasome subunit alpha type-5 (E.C.3.4.25.1), Proteasome subunit alpha type-6 (E.C.3.4.25.1), Probable proteasome subunit alpha type-7 (E.C.3.4.25.1), Proteasome subunit alpha type-1 (E.C.3.4.25.1), Proteasome subunit beta type-7 (E.C.3.4.25.1), Proteasome subunit beta type-3 (E.C.3.4.25.1), Proteasome subunit beta type-4 (E.C.3.4.25.1), Proteasome subunit beta type-5 (E.C.3.4.25.1), Proteasome subunit beta type-6 (E.C.3.4.25.1), Proteasome subunit beta type-1 (E.C.3.4.25.1)


Functional site

1) chain L
residue 126
type
ligand
sequence D
description binding site for residue GTW K 301
source : AC5

2) chain L
residue 130
type
ligand
sequence S
description binding site for residue GTW K 301
source : AC5

3) chain L
residue 132
type
ligand
sequence E
description binding site for residue GTW K 301
source : AC5

4) chain L
residue 222
type
ligand
sequence D
description binding site for residue MG V 302
source : AC9

5) chain L
residue 13-60
type prosite
ligand
sequence LGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVM
SANGFAAD
description Proteasome beta-type subunits signature.[LIVMACFT]-[GSA]-[LIVMF]-x-[FYLVGAC]-x(2)-[GSACFYI]-[LIVMSTACF]-[LIVMSTAC]-[LIVMFSTAC]-[GACI]-[GSTACV]-[DES]-x(15,16)-[RK]-x(12,13)-G-x(2)-[GSTA]-D.
source prosite : PS00854


Display surface

Download
Links