eF-site ID 6hvs-W PDB Code 6hvs Chain W click to enlarge Title Yeast 20S proteasome with human beta2i (1-53) in complex with 18 Classification HYDROLASE Compound Proteasome subunit alpha type-2 Source ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae S288C; Sequence W:  SDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFE KIFHYGHVFLGITGLATDVTTLNEMFRYKTNLYKLKEERA IEPETFTQLVSSSLYERRFGPYFVGPVVAGINSKSGKPFI AGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPE DLFETISQALLNAADRDALSGWGAVVYIIKKDEVVKRYLK MRQD Description Functional site 1) chain W residue 204 type sequence D description binding site for residue MG K 302 source : AC6 2) chain W residue 174 type sequence A description binding site for residue MG W 301 source : AD1 3) chain W residue 177 type sequence D description binding site for residue MG W 301 source : AD1 4) chain W residue 180 type sequence S description binding site for residue MG W 301 source : AD1 5) chain W residue 204 type sequence D description binding site for residue MG W 301 source : AD1 6) chain W residue 124 type sequence D description binding site for Di-peptide GRT V 301 and THR V 1 source : AD4 7) chain W residue 125 type sequence L description binding site for Di-peptide GRT V 301 and THR V 1 source : AD4 8) chain W residue 128 type sequence C description binding site for Di-peptide GRT V 301 and THR V 1 source : AD4 9) chain W residue 69 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2

Display surface Download Links