eF-site ID 6hva-L PDB Code 6hva Chain L click to enlarge Title Yeast 20S proteasome with human beta2i (1-53) in complex with 13 Classification HYDROLASE Compound Proteasome subunit alpha type-2 Source ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae S288C; Sequence L:  QFNPYGDNGGTILGIAGEDFAVLAGDTRNITDYSINSRYE PKVFDCGDNIVMSANGFAADGDALVKRFKNSVKWYHFDHN DKKLSINSAARNIQHLLYGKRFFPYYVHTIIAGLDEDGKG AVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQY EPGTNGKVKKPLKYLSVEEVIKLVRDSFTSATERHIQVGD GLEILIVTKDGVRKEFYELKRD Description Functional site 1) chain L residue 126 type sequence D description binding site for residue GQT K 301 source : AC6 2) chain L residue 127 type sequence P description binding site for residue GQT K 301 source : AC6 3) chain L residue 130 type sequence S description binding site for residue GQT K 301 source : AC6 4) chain L residue 222 type sequence D description binding site for residue MG L 301 source : AC8 5) chain L residue 13-60 type prosite sequence LGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVM SANGFAAD description PROTEASOME_BETA_1 Proteasome beta-type subunits signature. ISMkYdnGVIIAADnlgsygsllrfngve.RlipvgdntvvgisGdiSD source prosite : PS00854

Display surface Download Links