eF-site ID 6hub-b PDB Code 6hub Chain b click to enlarge Title Yeast 20S proteasome with human beta2c (S171G) in complex with 16 Classification HYDROLASE Compound Proteasome subunit alpha type-2 Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae (strain ATCC 204508 / S288c); Sequence b:  TSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDK IWCCRSGSAADTQAIADIVQYHLELYTSQYGTPSTETAAS VFKELCYENKDNLTAGIIVAGYDDKNKGEVYTIPLGGSVH KLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLS QAIKWDGSSGGVIRMVVLTAAGVERLIFYPDEYEQL Description Functional site 1) chain b residue 1 type sequence T description binding site for residue SO4 b 201 source : AD5 2) chain b residue 46 type sequence S description binding site for residue SO4 b 201 source : AD5 3) chain b residue 47 type sequence G description binding site for residue SO4 b 201 source : AD5 4) chain b residue 128 type sequence G description binding site for residue SO4 b 201 source : AD5 5) chain b residue 129 type sequence S description binding site for residue SO4 b 201 source : AD5 6) chain b residue 4-51 type prosite sequence MAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWC CRSGSAAD description PROTEASOME_BETA_1 Proteasome beta-type subunits signature. MAVtFkdGVILGADsrtttgayianrvtd.KltrvhdkiwccrsGsaAD source prosite : PS00854 7) chain b residue 1 type ACT_SITE sequence T description Nucleophile => ECO:0000269|PubMed:9087403 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links