eF-site ID 6hub-V PDB Code 6hub Chain V click to enlarge Title Yeast 20S proteasome with human beta2c (S171G) in complex with 16 Classification HYDROLASE Compound Proteasome subunit alpha type-2 Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae (strain ATCC 204508 / S288c); Sequence V:  TTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPN IYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTAN RMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTD KLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIA AGIFNDLGSGGNIDLCVISKNKLDFLRPYTVPNKKGTRLG RYRCEKGTTAVLTEKITPL Description Functional site 1) chain V residue 163 type sequence I description binding site for residue MG L 301 source : AC8 2) chain V residue 164 type sequence F description binding site for residue MG L 301 source : AC8 3) chain V residue 166 type sequence D description binding site for residue MG L 301 source : AC8 4) chain V residue 167 type sequence L description binding site for residue MG L 301 source : AC8 5) chain V residue 169 type sequence S description binding site for residue MG L 301 source : AC8 6) chain V residue 2 type sequence T description binding site for Di-peptide GRW V 301 and THR V 1 source : AD6 7) chain V residue 17 type sequence D description binding site for Di-peptide GRW V 301 and THR V 1 source : AD6 8) chain V residue 21 type sequence T description binding site for Di-peptide GRW V 301 and THR V 1 source : AD6 9) chain V residue 22 type sequence E description binding site for Di-peptide GRW V 301 and THR V 1 source : AD6 10) chain V residue 31 type sequence C description binding site for Di-peptide GRW V 301 and THR V 1 source : AD6 11) chain V residue 33 type sequence K description binding site for Di-peptide GRW V 301 and THR V 1 source : AD6 12) chain V residue 45 type sequence G description binding site for Di-peptide GRW V 301 and THR V 1 source : AD6 13) chain V residue 47 type sequence G description binding site for Di-peptide GRW V 301 and THR V 1 source : AD6 14) chain V residue 48 type sequence T description binding site for Di-peptide GRW V 301 and THR V 1 source : AD6 15) chain V residue 49 type sequence A description binding site for Di-peptide GRW V 301 and THR V 1 source : AD6 16) chain V residue 53 type sequence D description binding site for Di-peptide GRW V 301 and THR V 1 source : AD6 17) chain V residue 128 type sequence G description binding site for Di-peptide GRW V 301 and THR V 1 source : AD6 18) chain V residue 129 type sequence S description binding site for Di-peptide GRW V 301 and THR V 1 source : AD6 19) chain V residue 130 type sequence G description binding site for Di-peptide GRW V 301 and THR V 1 source : AD6 20) chain V residue 168 type sequence G description binding site for Di-peptide GRW V 301 and THR V 1 source : AD6 21) chain V residue 169 type sequence S description binding site for Di-peptide GRW V 301 and THR V 1 source : AD6

Display surface Download Links