eF-site ID 6hqb-L
PDB Code 6hqb
Chain L

click to enlarge
Title Monomeric cyanobacterial photosystem I
Classification PHOTOSYNTHESIS
Compound Photosystem I P700 chlorophyll a apoprotein A1
Source ORGANISM_SCIENTIFIC: Synechocystis sp. (strain PCC 6803 / Kazusa);
Sequence L:  TPISDSAFTRTFIGNLPAYRKGLSPILRGLEVGMAHGYFL
IGPWTLLGPLRDSEYQYIGGLIGALALILVATAALSSYGL
VTFQGEQGSGDTLQTADGWSQFAAGFFVGGMGGAFVAYFL
LENLSVVDGIFRGLFNH
Description (1)  Photosystem I P700 chlorophyll a apoprotein A1 (E.C.1.97.1.12), Photosystem I P700 chlorophyll a apoprotein A2 (E.C.1.97.1.12), Photosystem I iron-sulfur center (E.C.1.97.1.12), Photosystem I reaction center subunit II, Photosystem I reaction center subunit IV, Photosystem I reaction center subunit III, Photosystem I reaction center subunit VIII, Photosystem I reaction center subunit IX, Photosystem I reaction center subunit PsaK 2, Photosystem I reaction center subunit XI, Photosystem I reaction center subunit XII


Functional site

1) chain L
residue 22
type
ligand
sequence T
description binding site for residue CLA A 1129
source : AF4

2) chain L
residue 23
type
ligand
sequence P
description binding site for residue CLA A 1129
source : AF4

3) chain L
residue 64
type
ligand
sequence P
description binding site for residue CLA A 1131
source : AF5

4) chain L
residue 68
type
ligand
sequence L
description binding site for residue CLA A 1131
source : AF5

5) chain L
residue 22
type
ligand
sequence T
description binding site for residue CLA A 1130
source : AH7

6) chain L
residue 24
type
ligand
sequence I
description binding site for residue CLA A 1130
source : AH7

7) chain L
residue 25
type
ligand
sequence S
description binding site for residue CLA A 1130
source : AH7

8) chain L
residue 34
type
ligand
sequence I
description binding site for residue CLA A 1130
source : AH7

9) chain L
residue 60
type
ligand
sequence F
description binding site for residue CLA A 1132
source : AH8

10) chain L
residue 64
type
ligand
sequence P
description binding site for residue CLA A 1132
source : AH8

11) chain L
residue 65
type
ligand
sequence W
description binding site for residue CLA A 1132
source : AH8

12) chain L
residue 68
type
ligand
sequence L
description binding site for residue CLA A 1132
source : AH8

13) chain L
residue 69
type
ligand
sequence G
description binding site for residue CLA A 1132
source : AH8

14) chain L
residue 70
type
ligand
sequence P
description binding site for residue CLA A 1132
source : AH8

15) chain L
residue 65
type
ligand
sequence W
description binding site for residue CLA B 1207
source : AJ3

16) chain L
residue 70
type
ligand
sequence P
description binding site for residue CLA B 1207
source : AJ3

17) chain L
residue 157
type
ligand
sequence N
description binding site for residue CLA B 1228
source : AL6

18) chain L
residue 157
type
ligand
sequence N
description binding site for residue CLA B 1229
source : AL7

19) chain L
residue 153
type
ligand
sequence R
description binding site for residue CLA B 1235
source : AM3

20) chain L
residue 95
type
ligand
sequence A
description binding site for residue CLA B 1238
source : AO2

21) chain L
residue 99
type
ligand
sequence Y
description binding site for residue CLA B 1238
source : AO2

22) chain L
residue 102
type
ligand
sequence V
description binding site for residue CLA B 1238
source : AO2

23) chain L
residue 103
type
ligand
sequence T
description binding site for residue CLA B 1238
source : AO2

24) chain L
residue 153
type
ligand
sequence R
description binding site for residue CLA F 1302
source : AO7

25) chain L
residue 156
type
ligand
sequence F
description binding site for residue C7Z F 4016
source : AO9

26) chain L
residue 157
type
ligand
sequence N
description binding site for residue C7Z F 4016
source : AO9

27) chain L
residue 158
type
ligand
sequence H
description binding site for residue C7Z F 4016
source : AO9

28) chain L
residue 88
type
ligand
sequence L
description binding site for residue EQ3 I 4020
source : AP3

29) chain L
residue 149
type
ligand
sequence D
description binding site for residue CLA J 1303
source : AP5

30) chain L
residue 151
type
ligand
sequence I
description binding site for residue CLA J 1303
source : AP5

31) chain L
residue 70
type
ligand
sequence P
description binding site for residue CA L 1001
source : AQ2

32) chain L
residue 73
type
ligand
sequence D
description binding site for residue CA L 1001
source : AQ2

33) chain L
residue 33
type
ligand
sequence F
description binding site for residue CLA L 1502
source : AQ3

34) chain L
residue 37
type
ligand
sequence L
description binding site for residue CLA L 1502
source : AQ3

35) chain L
residue 52
type
ligand
sequence E
description binding site for residue CLA L 1502
source : AQ3

36) chain L
residue 53
type
ligand
sequence V
description binding site for residue CLA L 1502
source : AQ3

37) chain L
residue 56
type
ligand
sequence A
description binding site for residue CLA L 1502
source : AQ3

38) chain L
residue 57
type
ligand
sequence H
description binding site for residue CLA L 1502
source : AQ3

39) chain L
residue 60
type
ligand
sequence F
description binding site for residue CLA L 1502
source : AQ3

40) chain L
residue 92
type
ligand
sequence A
description binding site for residue CLA L 1502
source : AQ3

41) chain L
residue 96
type
ligand
sequence L
description binding site for residue CLA L 1502
source : AQ3

42) chain L
residue 120
type
ligand
sequence W
description binding site for residue CLA L 1502
source : AQ3

43) chain L
residue 123
type
ligand
sequence F
description binding site for residue CLA L 1502
source : AQ3

44) chain L
residue 22-24
type binding
ligand CLA: CHLOROPHYLL A
sequence TPI
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1129

45) chain L
residue 22
type binding
ligand CLA: CHLOROPHYLL A
sequence T
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1130

46) chain L
residue 24-25
type binding
ligand CLA: CHLOROPHYLL A
sequence IS
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1130

47) chain L
residue 30
type binding
ligand CLA: CHLOROPHYLL A
sequence T
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1130

48) chain L
residue 34
type binding
ligand CLA: CHLOROPHYLL A
sequence I
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1130

49) chain L
residue 95
type binding
ligand CLA: CHLOROPHYLL A
sequence A
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1237

50) chain L
residue 99
type binding
ligand CLA: CHLOROPHYLL A
sequence Y
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1237

51) chain L
residue 64
type binding
ligand CLA: CHLOROPHYLL A
sequence P
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1131

52) chain L
residue 68
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1131

53) chain L
residue 60-61
type binding
ligand CLA: CHLOROPHYLL A
sequence FL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1132

54) chain L
residue 64-65
type binding
ligand CLA: CHLOROPHYLL A
sequence PW
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1132

55) chain L
residue 68-72
type binding
ligand CLA: CHLOROPHYLL A
sequence LGPLR
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1132

56) chain L
residue 88
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1132

57) chain L
residue 95
type binding
ligand CLA: CHLOROPHYLL A
sequence A
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1238

58) chain L
residue 99
type binding
ligand CLA: CHLOROPHYLL A
sequence Y
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1238

59) chain L
residue 102-103
type binding
ligand CLA: CHLOROPHYLL A
sequence VT
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1238

60) chain L
residue 65
type binding
ligand CLA: CHLOROPHYLL A
sequence W
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1207

61) chain L
residue 70-71
type binding
ligand CLA: CHLOROPHYLL A
sequence PL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1207

62) chain L
residue 80
type binding
ligand CLA: CHLOROPHYLL A
sequence G
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1207

63) chain L
residue 83-84
type binding
ligand CLA: CHLOROPHYLL A
sequence IG
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1207

64) chain L
residue 60-61
type binding
ligand EQ3: (3'R)-3'-hydroxy-beta,beta-caroten-4-one
sequence FL
description (3'R)-3'-hydroxy-beta,beta-caroten-4-one binding site
source pdb_hetatom : EQ3_6hqb_I_4020

65) chain L
residue 65
type binding
ligand EQ3: (3'R)-3'-hydroxy-beta,beta-caroten-4-one
sequence W
description (3'R)-3'-hydroxy-beta,beta-caroten-4-one binding site
source pdb_hetatom : EQ3_6hqb_I_4020

66) chain L
residue 84
type binding
ligand EQ3: (3'R)-3'-hydroxy-beta,beta-caroten-4-one
sequence G
description (3'R)-3'-hydroxy-beta,beta-caroten-4-one binding site
source pdb_hetatom : EQ3_6hqb_I_4020

67) chain L
residue 87-88
type binding
ligand EQ3: (3'R)-3'-hydroxy-beta,beta-caroten-4-one
sequence AL
description (3'R)-3'-hydroxy-beta,beta-caroten-4-one binding site
source pdb_hetatom : EQ3_6hqb_I_4020

68) chain L
residue 91
type binding
ligand EQ3: (3'R)-3'-hydroxy-beta,beta-caroten-4-one
sequence V
description (3'R)-3'-hydroxy-beta,beta-caroten-4-one binding site
source pdb_hetatom : EQ3_6hqb_I_4020

69) chain L
residue 33
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_L_1502

70) chain L
residue 37
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_L_1502

71) chain L
residue 52-53
type binding
ligand CLA: CHLOROPHYLL A
sequence EV
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_L_1502

72) chain L
residue 56-57
type binding
ligand CLA: CHLOROPHYLL A
sequence AH
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_L_1502

73) chain L
residue 60-61
type binding
ligand CLA: CHLOROPHYLL A
sequence FL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_L_1502

74) chain L
residue 88
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_L_1502

75) chain L
residue 92
type binding
ligand CLA: CHLOROPHYLL A
sequence A
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_L_1502

76) chain L
residue 95-96
type binding
ligand CLA: CHLOROPHYLL A
sequence AL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_L_1502

77) chain L
residue 99
type binding
ligand CLA: CHLOROPHYLL A
sequence Y
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_L_1502

78) chain L
residue 114
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_L_1502

79) chain L
residue 120
type binding
ligand CLA: CHLOROPHYLL A
sequence W
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_L_1502

80) chain L
residue 123
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_L_1502

81) chain L
residue 127
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_L_1502


Display surface

Download
Links