eF-site ID 6hqb-K
PDB Code 6hqb
Chain K

click to enlarge
Title Monomeric cyanobacterial photosystem I
Classification PHOTOSYNTHESIS
Compound Photosystem I P700 chlorophyll a apoprotein A1
Source ORGANISM_SCIENTIFIC: Synechocystis sp. (strain PCC 6803 / Kazusa);
Sequence K:  WSLSVGIIMCLCNVFAFVIGYFAIQKTGKGKDLALPQLAS
KKTFGLPELLATMSFGHILGAGMVLGLASS
Description (1)  Photosystem I P700 chlorophyll a apoprotein A1 (E.C.1.97.1.12), Photosystem I P700 chlorophyll a apoprotein A2 (E.C.1.97.1.12), Photosystem I iron-sulfur center (E.C.1.97.1.12), Photosystem I reaction center subunit II, Photosystem I reaction center subunit IV, Photosystem I reaction center subunit III, Photosystem I reaction center subunit VIII, Photosystem I reaction center subunit IX, Photosystem I reaction center subunit PsaK 2, Photosystem I reaction center subunit XI, Photosystem I reaction center subunit XII


Functional site

1) chain K
residue 49
type
ligand
sequence D
description binding site for residue CLA A 1118
source : AE2

2) chain K
residue 63
type
ligand
sequence L
description binding site for residue CLA A 1118
source : AE2

3) chain K
residue 64
type
ligand
sequence P
description binding site for residue CLA A 1118
source : AE2

4) chain K
residue 67
type
ligand
sequence L
description binding site for residue CLA A 1118
source : AE2

5) chain K
residue 68
type
ligand
sequence A
description binding site for residue CLA A 1118
source : AE2

6) chain K
residue 42
type
ligand
sequence Q
description binding site for residue CLA A 1120
source : AE4

7) chain K
residue 41
type
ligand
sequence I
description binding site for residue BCR A 4001
source : AG8

8) chain K
residue 68
type
ligand
sequence A
description binding site for residue BCR A 4001
source : AG8

9) chain K
residue 71
type
ligand
sequence S
description binding site for residue BCR A 4001
source : AG8

10) chain K
residue 72
type
ligand
sequence F
description binding site for residue BCR A 4001
source : AG8

11) chain K
residue 76
type
ligand
sequence L
description binding site for residue CLA K 1401
source : AP8

12) chain K
residue 79
type
ligand
sequence G
description binding site for residue CLA K 1401
source : AP8

13) chain K
residue 80
type
ligand
sequence M
description binding site for residue CLA K 1401
source : AP8

14) chain K
residue 18
type
ligand
sequence W
description binding site for residue CLA K 1402
source : AP9

15) chain K
residue 22
type
ligand
sequence V
description binding site for residue CLA K 1402
source : AP9

16) chain K
residue 26
type
ligand
sequence M
description binding site for residue CLA K 1402
source : AP9

17) chain K
residue 27
type
ligand
sequence C
description binding site for residue CLA K 1402
source : AP9

18) chain K
residue 30
type
ligand
sequence N
description binding site for residue CLA K 1402
source : AP9

19) chain K
residue 58
type
ligand
sequence K
description binding site for residue CLA K 1402
source : AP9

20) chain K
residue 74
type
ligand
sequence H
description binding site for residue CLA K 1402
source : AP9

21) chain K
residue 55
type
ligand
sequence L
description binding site for residue BCR K 4001
source : AQ1

22) chain K
residue 67
type
ligand
sequence L
description binding site for residue BCR K 4001
source : AQ1

23) chain K
residue 70
type
ligand
sequence M
description binding site for residue BCR K 4001
source : AQ1

24) chain K
residue 71
type
ligand
sequence S
description binding site for residue BCR K 4001
source : AQ1

25) chain K
residue 74
type
ligand
sequence H
description binding site for residue BCR K 4001
source : AQ1

26) chain K
residue 75
type
ligand
sequence I
description binding site for residue BCR K 4001
source : AQ1

27) chain K
residue 49
type binding
ligand CLA: CHLOROPHYLL A
sequence D
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1118

28) chain K
residue 63-64
type binding
ligand CLA: CHLOROPHYLL A
sequence LP
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1118

29) chain K
residue 67-68
type binding
ligand CLA: CHLOROPHYLL A
sequence LA
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1118

30) chain K
residue 71
type binding
ligand CLA: CHLOROPHYLL A
sequence S
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1118

31) chain K
residue 33
type binding
ligand BCR: BETA-CAROTENE
sequence A
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_A_4001

32) chain K
residue 36-37
type binding
ligand BCR: BETA-CAROTENE
sequence IG
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_A_4001

33) chain K
residue 41
type binding
ligand BCR: BETA-CAROTENE
sequence I
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_A_4001

34) chain K
residue 68-69
type binding
ligand BCR: BETA-CAROTENE
sequence AT
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_A_4001

35) chain K
residue 71-72
type binding
ligand BCR: BETA-CAROTENE
sequence SF
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_A_4001

36) chain K
residue 18
type binding
ligand CLA: CHLOROPHYLL A
sequence W
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_K_1402

37) chain K
residue 21-22
type binding
ligand CLA: CHLOROPHYLL A
sequence SV
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_K_1402

38) chain K
residue 26-27
type binding
ligand CLA: CHLOROPHYLL A
sequence MC
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_K_1402

39) chain K
residue 30-31
type binding
ligand CLA: CHLOROPHYLL A
sequence NV
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_K_1402

40) chain K
residue 34
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_K_1402

41) chain K
residue 58
type binding
ligand CLA: CHLOROPHYLL A
sequence K
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_K_1402

42) chain K
residue 70
type binding
ligand CLA: CHLOROPHYLL A
sequence M
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_K_1402

43) chain K
residue 74
type binding
ligand CLA: CHLOROPHYLL A
sequence H
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_K_1402

44) chain K
residue 75
type binding
ligand CLA: CHLOROPHYLL A
sequence I
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1115

45) chain K
residue 78-79
type binding
ligand CLA: CHLOROPHYLL A
sequence AG
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1115

46) chain K
residue 82-83
type binding
ligand CLA: CHLOROPHYLL A
sequence LG
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1115

47) chain K
residue 86
type binding
ligand CLA: CHLOROPHYLL A
sequence S
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1115

48) chain K
residue 53
type binding
ligand BCR: BETA-CAROTENE
sequence P
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_K_4001

49) chain K
residue 55
type binding
ligand BCR: BETA-CAROTENE
sequence L
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_K_4001

50) chain K
residue 58-59
type binding
ligand BCR: BETA-CAROTENE
sequence KK
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_K_4001

51) chain K
residue 67
type binding
ligand BCR: BETA-CAROTENE
sequence L
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_K_4001

52) chain K
residue 70-71
type binding
ligand BCR: BETA-CAROTENE
sequence MS
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_K_4001

53) chain K
residue 74-75
type binding
ligand BCR: BETA-CAROTENE
sequence HI
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_K_4001

54) chain K
residue 78
type binding
ligand BCR: BETA-CAROTENE
sequence A
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_K_4001

55) chain K
residue 40-42
type binding
ligand CLA: CHLOROPHYLL A
sequence AIQ
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1120

56) chain K
residue 75-76
type binding
ligand CLA: CHLOROPHYLL A
sequence IL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_K_1401

57) chain K
residue 79-80
type binding
ligand CLA: CHLOROPHYLL A
sequence GM
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_K_1401

58) chain K
residue 83
type binding
ligand CLA: CHLOROPHYLL A
sequence G
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_K_1401


Display surface

Download
Links