eF-site ID 6hqb-J
PDB Code 6hqb
Chain J

click to enlarge
Title Monomeric cyanobacterial photosystem I
Classification PHOTOSYNTHESIS
Compound Photosystem I P700 chlorophyll a apoprotein A1
Source ORGANISM_SCIENTIFIC: Synechocystis sp. (strain PCC 6803 / Kazusa);
Sequence J:  MDGLKSFLSTAPVMIMALLTFTAGILIEFNRFYPDLLFHP
Description (1)  Photosystem I P700 chlorophyll a apoprotein A1 (E.C.1.97.1.12), Photosystem I P700 chlorophyll a apoprotein A2 (E.C.1.97.1.12), Photosystem I iron-sulfur center (E.C.1.97.1.12), Photosystem I reaction center subunit II, Photosystem I reaction center subunit IV, Photosystem I reaction center subunit III, Photosystem I reaction center subunit VIII, Photosystem I reaction center subunit IX, Photosystem I reaction center subunit PsaK 2, Photosystem I reaction center subunit XI, Photosystem I reaction center subunit XII


Functional site

1) chain J
residue 8
type
ligand
sequence L
description binding site for residue CLA A 1105
source : AC7

2) chain J
residue 13
type
ligand
sequence V
description binding site for residue CLA A 1105
source : AC7

3) chain J
residue 20
type
ligand
sequence T
description binding site for residue CLA A 1105
source : AC7

4) chain J
residue 27
type
ligand
sequence I
description binding site for residue CLA A 1107
source : AC9

5) chain J
residue 7
type
ligand
sequence F
description binding site for residue CLA A 1109
source : AD2

6) chain J
residue 15
type
ligand
sequence I
description binding site for residue CLA A 1139
source : AG3

7) chain J
residue 18
type
ligand
sequence L
description binding site for residue CLA A 1139
source : AG3

8) chain J
residue 19
type
ligand
sequence L
description binding site for residue CLA A 1140
source : AG4

9) chain J
residue 7
type
ligand
sequence F
description binding site for residue CLA A 1101
source : AH5

10) chain J
residue 11
type
ligand
sequence A
description binding site for residue CLA A 1101
source : AH5

11) chain J
residue 12
type
ligand
sequence P
description binding site for residue CLA A 1101
source : AH5

12) chain J
residue 23
type
ligand
sequence A
description binding site for residue BCR A 4012
source : AH6

13) chain J
residue 26
type
ligand
sequence L
description binding site for residue BCR A 4012
source : AH6

14) chain J
residue 30
type
ligand
sequence N
description binding site for residue CLA B 1230
source : AL8

15) chain J
residue 35
type
ligand
sequence D
description binding site for residue CLA B 1230
source : AL8

16) chain J
residue 36
type
ligand
sequence L
description binding site for residue CLA B 1230
source : AL8

17) chain J
residue 37
type
ligand
sequence L
description binding site for residue CLA B 1230
source : AL8

18) chain J
residue 18
type
ligand
sequence L
description binding site for residue CLA F 1301
source : AO6

19) chain J
residue 22
type
ligand
sequence T
description binding site for residue CLA F 1301
source : AO6

20) chain J
residue 26
type
ligand
sequence L
description binding site for residue CLA F 1301
source : AO6

21) chain J
residue 2
type
ligand
sequence D
description binding site for residue LMT F 6001
source : AP1

22) chain J
residue 5
type
ligand
sequence K
description binding site for residue LMT F 6001
source : AP1

23) chain J
residue 6
type
ligand
sequence S
description binding site for residue LMT F 6001
source : AP1

24) chain J
residue 8
type
ligand
sequence L
description binding site for residue LMT F 6001
source : AP1

25) chain J
residue 9
type
ligand
sequence S
description binding site for residue LMT F 6001
source : AP1

26) chain J
residue 33
type
ligand
sequence Y
description binding site for residue C7Z J 4015
source : AP4

27) chain J
residue 37
type
ligand
sequence L
description binding site for residue C7Z J 4015
source : AP4

28) chain J
residue 38
type
ligand
sequence F
description binding site for residue C7Z J 4015
source : AP4

29) chain J
residue 39
type
ligand
sequence H
description binding site for residue C7Z J 4015
source : AP4

30) chain J
residue 40
type
ligand
sequence P
description binding site for residue C7Z J 4015
source : AP4

31) chain J
residue 39
type
ligand
sequence H
description binding site for residue CLA J 1303
source : AP5

32) chain J
residue 21
type
ligand
sequence F
description binding site for residue CLA J 1302
source : AP6

33) chain J
residue 24
type
ligand
sequence G
description binding site for residue CLA J 1302
source : AP6

34) chain J
residue 25
type
ligand
sequence I
description binding site for residue CLA J 1302
source : AP6

35) chain J
residue 28
type
ligand
sequence E
description binding site for residue CLA J 1302
source : AP6

36) chain J
residue 31
type
ligand
sequence R
description binding site for residue CLA J 1302
source : AP6

37) chain J
residue 32
type
ligand
sequence F
description binding site for residue CLA J 1302
source : AP6

38) chain J
residue 12
type
ligand
sequence P
description binding site for residue BCR J 4013
source : AP7

39) chain J
residue 20
type
ligand
sequence T
description binding site for residue BCR J 4013
source : AP7

40) chain J
residue 27
type
ligand
sequence I
description binding site for residue BCR J 4013
source : AP7

41) chain J
residue 28
type
ligand
sequence E
description binding site for residue BCR J 4013
source : AP7

42) chain J
residue 31
type
ligand
sequence R
description binding site for residue BCR J 4013
source : AP7

43) chain J
residue 7
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1109

44) chain J
residue 7
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1101

45) chain J
residue 11-12
type binding
ligand CLA: CHLOROPHYLL A
sequence AP
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1101

46) chain J
residue 15
type binding
ligand CLA: CHLOROPHYLL A
sequence I
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1101

47) chain J
residue 7
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1102

48) chain J
residue 11
type binding
ligand CLA: CHLOROPHYLL A
sequence A
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1139

49) chain J
residue 14-15
type binding
ligand CLA: CHLOROPHYLL A
sequence MI
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1139

50) chain J
residue 18
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1139

51) chain J
residue 16
type binding
ligand CLA: CHLOROPHYLL A
sequence M
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1140

52) chain J
residue 19
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1140

53) chain J
residue 22-23
type binding
ligand CLA: CHLOROPHYLL A
sequence TA
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1140

54) chain J
residue 15-16
type binding
ligand PQN: PHYLLOQUINONE
sequence IM
description PHYLLOQUINONE binding site
source pdb_hetatom : PQN_6hqb_A_2001

55) chain J
residue 19
type binding
ligand PQN: PHYLLOQUINONE
sequence L
description PHYLLOQUINONE binding site
source pdb_hetatom : PQN_6hqb_A_2001

56) chain J
residue 22-23
type binding
ligand BCR: BETA-CAROTENE
sequence TA
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_A_4012

57) chain J
residue 26-27
type binding
ligand BCR: BETA-CAROTENE
sequence LI
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_A_4012

58) chain J
residue 30
type binding
ligand BCR: BETA-CAROTENE
sequence N
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_A_4012

59) chain J
residue 7-8
type binding
ligand CLA: CHLOROPHYLL A
sequence FL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1105

60) chain J
residue 13
type binding
ligand CLA: CHLOROPHYLL A
sequence V
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1105

61) chain J
residue 16-17
type binding
ligand CLA: CHLOROPHYLL A
sequence MA
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1105

62) chain J
residue 20
type binding
ligand CLA: CHLOROPHYLL A
sequence T
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1105

63) chain J
residue 27
type binding
ligand CLA: CHLOROPHYLL A
sequence I
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1107

64) chain J
residue 7
type binding
ligand BCR: BETA-CAROTENE
sequence F
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_J_4013

65) chain J
residue 12-13
type binding
ligand BCR: BETA-CAROTENE
sequence PV
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_J_4013

66) chain J
residue 16
type binding
ligand BCR: BETA-CAROTENE
sequence M
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_J_4013

67) chain J
residue 20
type binding
ligand BCR: BETA-CAROTENE
sequence T
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_J_4013

68) chain J
residue 23-24
type binding
ligand BCR: BETA-CAROTENE
sequence AG
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_J_4013

69) chain J
residue 27-28
type binding
ligand BCR: BETA-CAROTENE
sequence IE
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_J_4013

70) chain J
residue 31
type binding
ligand BCR: BETA-CAROTENE
sequence R
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_J_4013

71) chain J
residue 20-21
type binding
ligand CLA: CHLOROPHYLL A
sequence TF
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_J_1302

72) chain J
residue 24-25
type binding
ligand CLA: CHLOROPHYLL A
sequence GI
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_J_1302

73) chain J
residue 28
type binding
ligand CLA: CHLOROPHYLL A
sequence E
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_J_1302

74) chain J
residue 31-32
type binding
ligand CLA: CHLOROPHYLL A
sequence RF
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_J_1302

75) chain J
residue 26
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1230

76) chain J
residue 29-30
type binding
ligand CLA: CHLOROPHYLL A
sequence FN
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1230

77) chain J
residue 34-38
type binding
ligand CLA: CHLOROPHYLL A
sequence PDLLF
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1230

78) chain J
residue 26
type binding
ligand BCR: BETA-CAROTENE
sequence L
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_F_4014

79) chain J
residue 33
type binding
ligand C7Z: (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol
sequence Y
description (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol binding site
source pdb_hetatom : C7Z_6hqb_J_4015

80) chain J
residue 36-40
type binding
ligand C7Z: (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol
sequence LLFHP
description (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol binding site
source pdb_hetatom : C7Z_6hqb_J_4015

81) chain J
residue 29
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_J_1303

82) chain J
residue 39-40
type binding
ligand CLA: CHLOROPHYLL A
sequence HP
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_J_1303

83) chain J
residue 15
type binding
ligand CLA: CHLOROPHYLL A
sequence I
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_F_1301

84) chain J
residue 18-19
type binding
ligand CLA: CHLOROPHYLL A
sequence LL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_F_1301

85) chain J
residue 22
type binding
ligand CLA: CHLOROPHYLL A
sequence T
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_F_1301

86) chain J
residue 25-26
type binding
ligand CLA: CHLOROPHYLL A
sequence IL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_F_1301

87) chain J
residue 2
type binding
ligand LMT: DODECYL-BETA-D-MALTOSIDE
sequence D
description DODECYL-BETA-D-MALTOSIDE binding site
source pdb_hetatom : LMT_6hqb_F_6001

88) chain J
residue 5-6
type binding
ligand LMT: DODECYL-BETA-D-MALTOSIDE
sequence KS
description DODECYL-BETA-D-MALTOSIDE binding site
source pdb_hetatom : LMT_6hqb_F_6001

89) chain J
residue 8-9
type binding
ligand LMT: DODECYL-BETA-D-MALTOSIDE
sequence LS
description DODECYL-BETA-D-MALTOSIDE binding site
source pdb_hetatom : LMT_6hqb_F_6001

90) chain J
residue 13-14
type binding
ligand LMT: DODECYL-BETA-D-MALTOSIDE
sequence VM
description DODECYL-BETA-D-MALTOSIDE binding site
source pdb_hetatom : LMT_6hqb_F_6001

91) chain J
residue 17
type binding
ligand LMT: DODECYL-BETA-D-MALTOSIDE
sequence A
description DODECYL-BETA-D-MALTOSIDE binding site
source pdb_hetatom : LMT_6hqb_F_6001


Display surface

Download
Links