eF-site ID 6hqb-F
PDB Code 6hqb
Chain F

click to enlarge
Title Monomeric cyanobacterial photosystem I
Classification PHOTOSYNTHESIS
Compound Photosystem I P700 chlorophyll a apoprotein A1
Source ORGANISM_SCIENTIFIC: Synechocystis sp. (strain PCC 6803 / Kazusa);
Sequence F:  ADDFANLTPCSENPAYLAKSKNFLNTTNDPNSGKIRAERY
ASALCGPEGYPHLIVDGRFTHAGDFLIPSILFLYIAGWIG
WVGRSYLIEIRESKNPEMQEVVINVPLAIKKMLGGFLWPL
AAVGEYTSGKLVMKDSEIPTSPR
Description (1)  Photosystem I P700 chlorophyll a apoprotein A1 (E.C.1.97.1.12), Photosystem I P700 chlorophyll a apoprotein A2 (E.C.1.97.1.12), Photosystem I iron-sulfur center (E.C.1.97.1.12), Photosystem I reaction center subunit II, Photosystem I reaction center subunit IV, Photosystem I reaction center subunit III, Photosystem I reaction center subunit VIII, Photosystem I reaction center subunit IX, Photosystem I reaction center subunit PsaK 2, Photosystem I reaction center subunit XI, Photosystem I reaction center subunit XII


Functional site

1) chain F
residue 80
type
ligand
sequence G
description binding site for residue CLA A 1138
source : AG2

2) chain F
residue 83
type
ligand
sequence G
description binding site for residue CLA A 1138
source : AG2

3) chain F
residue 84
type
ligand
sequence R
description binding site for residue CLA A 1138
source : AG2

4) chain F
residue 86
type
ligand
sequence Y
description binding site for residue CLA A 1138
source : AG2

5) chain F
residue 100
type
ligand
sequence E
description binding site for residue CLA A 1139
source : AG3

6) chain F
residue 103
type
ligand
sequence I
description binding site for residue CLA A 1139
source : AG3

7) chain F
residue 112
type
ligand
sequence M
description binding site for residue CLA A 1139
source : AG3

8) chain F
residue 101
type
ligand
sequence V
description binding site for residue CLA A 1101
source : AH5

9) chain F
residue 132
type
ligand
sequence V
description binding site for residue CLA B 1228
source : AL6

10) chain F
residue 65
type
ligand
sequence F
description binding site for residue CLA B 1229
source : AL7

11) chain F
residue 69
type
ligand
sequence S
description binding site for residue CLA B 1229
source : AL7

12) chain F
residue 72
type
ligand
sequence F
description binding site for residue CLA B 1229
source : AL7

13) chain F
residue 76
type
ligand
sequence A
description binding site for residue CLA B 1229
source : AL7

14) chain F
residue 40
type
ligand
sequence Y
description binding site for residue CLA B 1230
source : AL8

15) chain F
residue 55
type
ligand
sequence V
description binding site for residue CLA B 1235
source : AM3

16) chain F
residue 65
type
ligand
sequence F
description binding site for residue CLA B 1235
source : AM3

17) chain F
residue 69
type
ligand
sequence S
description binding site for residue CLA B 1235
source : AM3

18) chain F
residue 126
type
ligand
sequence Y
description binding site for residue SQD F 5001
source : AO5

19) chain F
residue 132
type
ligand
sequence V
description binding site for residue SQD F 5001
source : AO5

20) chain F
residue 134
type
ligand
sequence K
description binding site for residue SQD F 5001
source : AO5

21) chain F
residue 135
type
ligand
sequence D
description binding site for residue SQD F 5001
source : AO5

22) chain F
residue 75
type
ligand
sequence I
description binding site for residue CLA F 1301
source : AO6

23) chain F
residue 78
type
ligand
sequence W
description binding site for residue CLA F 1301
source : AO6

24) chain F
residue 79
type
ligand
sequence I
description binding site for residue CLA F 1301
source : AO6

25) chain F
residue 82
type
ligand
sequence V
description binding site for residue CLA F 1301
source : AO6

26) chain F
residue 112
type
ligand
sequence M
description binding site for residue CLA F 1301
source : AO6

27) chain F
residue 56
type
ligand
sequence D
description binding site for residue CLA F 1302
source : AO7

28) chain F
residue 57
type
ligand
sequence G
description binding site for residue CLA F 1302
source : AO7

29) chain F
residue 58
type
ligand
sequence R
description binding site for residue CLA F 1302
source : AO7

30) chain F
residue 59
type
ligand
sequence F
description binding site for residue CLA F 1302
source : AO7

31) chain F
residue 71
type
ligand
sequence L
description binding site for residue BCR F 4014
source : AO8

32) chain F
residue 72
type
ligand
sequence F
description binding site for residue BCR F 4014
source : AO8

33) chain F
residue 75
type
ligand
sequence I
description binding site for residue BCR F 4014
source : AO8

34) chain F
residue 55
type
ligand
sequence V
description binding site for residue C7Z F 4016
source : AO9

35) chain F
residue 57
type
ligand
sequence G
description binding site for residue C7Z F 4016
source : AO9

36) chain F
residue 76
type
ligand
sequence A
description binding site for residue C7Z F 4016
source : AO9

37) chain F
residue 77
type
ligand
sequence G
description binding site for residue C7Z F 4016
source : AO9

38) chain F
residue 80
type
ligand
sequence G
description binding site for residue C7Z F 4016
source : AO9

39) chain F
residue 81
type
ligand
sequence W
description binding site for residue C7Z F 4016
source : AO9

40) chain F
residue 103
type
ligand
sequence I
description binding site for residue LMT F 6001
source : AP1

41) chain F
residue 104
type
ligand
sequence N
description binding site for residue LMT F 6001
source : AP1

42) chain F
residue 105
type
ligand
sequence V
description binding site for residue LMT F 6001
source : AP1

43) chain F
residue 106
type
ligand
sequence P
description binding site for residue LMT F 6001
source : AP1

44) chain F
residue 68
type
ligand
sequence P
description binding site for residue C7Z J 4015
source : AP4

45) chain F
residue 67
type
ligand
sequence I
description binding site for residue CLA J 1303
source : AP5

46) chain F
residue 101
type binding
ligand CLA: CHLOROPHYLL A
sequence V
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1101

47) chain F
residue 83
type binding
ligand CLA: CHLOROPHYLL A
sequence G
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1139

48) chain F
residue 86-87
type binding
ligand CLA: CHLOROPHYLL A
sequence YL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1139

49) chain F
residue 90
type binding
ligand CLA: CHLOROPHYLL A
sequence I
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1139

50) chain F
residue 100-101
type binding
ligand CLA: CHLOROPHYLL A
sequence EV
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1139

51) chain F
residue 103
type binding
ligand CLA: CHLOROPHYLL A
sequence I
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1139

52) chain F
residue 105
type binding
ligand CLA: CHLOROPHYLL A
sequence V
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1139

53) chain F
residue 108-109
type binding
ligand CLA: CHLOROPHYLL A
sequence AI
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1139

54) chain F
residue 112
type binding
ligand CLA: CHLOROPHYLL A
sequence M
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1139

55) chain F
residue 28
type binding
ligand BCR: BETA-CAROTENE
sequence N
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_J_4013

56) chain F
residue 40
type binding
ligand CLA: CHLOROPHYLL A
sequence Y
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1230

57) chain F
residue 71
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1230

58) chain F
residue 68
type binding
ligand BCR: BETA-CAROTENE
sequence P
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_F_4014

59) chain F
residue 71-72
type binding
ligand BCR: BETA-CAROTENE
sequence LF
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_F_4014

60) chain F
residue 75-76
type binding
ligand BCR: BETA-CAROTENE
sequence IA
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_F_4014

61) chain F
residue 79
type binding
ligand BCR: BETA-CAROTENE
sequence I
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_F_4014

62) chain F
residue 79-80
type binding
ligand CLA: CHLOROPHYLL A
sequence IG
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1138

63) chain F
residue 82-84
type binding
ligand CLA: CHLOROPHYLL A
sequence VGR
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1138

64) chain F
residue 86
type binding
ligand CLA: CHLOROPHYLL A
sequence Y
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1138

65) chain F
residue 103
type binding
ligand CLA: CHLOROPHYLL A
sequence I
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1138

66) chain F
residue 108
type binding
ligand CLA: CHLOROPHYLL A
sequence A
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1138

67) chain F
residue 112
type binding
ligand CLA: CHLOROPHYLL A
sequence M
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1138

68) chain F
residue 126
type binding
ligand CLA: CHLOROPHYLL A
sequence Y
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1228

69) chain F
residue 131-132
type binding
ligand CLA: CHLOROPHYLL A
sequence LV
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1228

70) chain F
residue 135
type binding
ligand CLA: CHLOROPHYLL A
sequence D
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1228

71) chain F
residue 126-127
type binding
ligand SQD: 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
sequence YT
description 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL binding site
source pdb_hetatom : SQD_6hqb_F_5001

72) chain F
residue 129
type binding
ligand SQD: 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
sequence G
description 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL binding site
source pdb_hetatom : SQD_6hqb_F_5001

73) chain F
residue 132-135
type binding
ligand SQD: 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
sequence VMKD
description 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL binding site
source pdb_hetatom : SQD_6hqb_F_5001

74) chain F
residue 143
type binding
ligand SQD: 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
sequence R
description 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL binding site
source pdb_hetatom : SQD_6hqb_F_5001

75) chain F
residue 55-57
type binding
ligand C7Z: (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol
sequence VDG
description (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol binding site
source pdb_hetatom : C7Z_6hqb_F_4016

76) chain F
residue 65
type binding
ligand C7Z: (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol
sequence F
description (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol binding site
source pdb_hetatom : C7Z_6hqb_F_4016

77) chain F
residue 76-81
type binding
ligand C7Z: (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol
sequence AGWIGW
description (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol binding site
source pdb_hetatom : C7Z_6hqb_F_4016

78) chain F
residue 84
type binding
ligand C7Z: (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol
sequence R
description (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol binding site
source pdb_hetatom : C7Z_6hqb_F_4016

79) chain F
residue 118
type binding
ligand C7Z: (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol
sequence W
description (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol binding site
source pdb_hetatom : C7Z_6hqb_F_4016

80) chain F
residue 122
type binding
ligand C7Z: (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol
sequence A
description (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol binding site
source pdb_hetatom : C7Z_6hqb_F_4016

81) chain F
residue 131
type binding
ligand C7Z: (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol
sequence L
description (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol binding site
source pdb_hetatom : C7Z_6hqb_F_4016

82) chain F
residue 65
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1229

83) chain F
residue 68-69
type binding
ligand CLA: CHLOROPHYLL A
sequence PS
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1229

84) chain F
residue 72-73
type binding
ligand CLA: CHLOROPHYLL A
sequence FL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1229

85) chain F
residue 76-77
type binding
ligand CLA: CHLOROPHYLL A
sequence AG
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1229

86) chain F
residue 79-80
type binding
ligand CLA: CHLOROPHYLL A
sequence IG
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1229

87) chain F
residue 55
type binding
ligand CLA: CHLOROPHYLL A
sequence V
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1235

88) chain F
residue 65-66
type binding
ligand CLA: CHLOROPHYLL A
sequence FL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1235

89) chain F
residue 69-70
type binding
ligand CLA: CHLOROPHYLL A
sequence SI
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1235

90) chain F
residue 73
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1235

91) chain F
residue 39
type binding
ligand C7Z: (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol
sequence R
description (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol binding site
source pdb_hetatom : C7Z_6hqb_J_4015

92) chain F
residue 53
type binding
ligand C7Z: (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol
sequence L
description (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol binding site
source pdb_hetatom : C7Z_6hqb_J_4015

93) chain F
residue 64-65
type binding
ligand C7Z: (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol
sequence DF
description (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol binding site
source pdb_hetatom : C7Z_6hqb_J_4015

94) chain F
residue 67-68
type binding
ligand C7Z: (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol
sequence IP
description (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol binding site
source pdb_hetatom : C7Z_6hqb_J_4015

95) chain F
residue 71
type binding
ligand C7Z: (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol
sequence L
description (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol binding site
source pdb_hetatom : C7Z_6hqb_J_4015

96) chain F
residue 4
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_F_1302

97) chain F
residue 56-59
type binding
ligand CLA: CHLOROPHYLL A
sequence DGRF
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_F_1302

98) chain F
residue 66
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_F_1302

99) chain F
residue 66-67
type binding
ligand CLA: CHLOROPHYLL A
sequence LI
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_J_1303

100) chain F
residue 70-71
type binding
ligand CLA: CHLOROPHYLL A
sequence IL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_J_1303

101) chain F
residue 74-75
type binding
ligand CLA: CHLOROPHYLL A
sequence YI
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_F_1301

102) chain F
residue 78-79
type binding
ligand CLA: CHLOROPHYLL A
sequence WI
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_F_1301

103) chain F
residue 82
type binding
ligand CLA: CHLOROPHYLL A
sequence V
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_F_1301

104) chain F
residue 112-113
type binding
ligand CLA: CHLOROPHYLL A
sequence ML
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_F_1301

105) chain F
residue 102-106
type binding
ligand LMT: DODECYL-BETA-D-MALTOSIDE
sequence VINVP
description DODECYL-BETA-D-MALTOSIDE binding site
source pdb_hetatom : LMT_6hqb_F_6001


Display surface

Download
Links