eF-site ID 6hqb-B
PDB Code 6hqb
Chain B

click to enlarge
Title Monomeric cyanobacterial photosystem I
Classification PHOTOSYNTHESIS
Compound Photosystem I P700 chlorophyll a apoprotein A1
Source ORGANISM_SCIENTIFIC: Synechocystis sp. (strain PCC 6803 / Kazusa);
Sequence B:  MATKFPKFSQDLAQDPTTRRIWYGIATAHDFETHDGMTEE
NLYQKIFASHFGHIAIIFLWTSGTLFHVAWQGNFEQWIKD
PLNIRPIAHAIWDPHFGEGAVNAFTQAGASNPVNIAYSGV
YHWFYTIGMTTNQELYSGAVFLLVLASLFLFAGWLHLQPK
FRPSLAWFKNAESRLNHHLAGLFGVSSLAWAGHLVHVAIP
EARGQHVGWDNFLSTPPHPAGLMPFFTGNWGVYAADPDTA
GHIFGTSEGAGTAILTFLGGFHPQTESLWLTDIAHHHLAI
AVIFIIAGHMYRTNWGIGHSIKEILNAHKGPLTGAGHTNL
YDTINNSLHFQLGLALASLGVITSLVAQHMYSLPSYAFIA
QDHTTQAALYTHHQYIAGFLMVGAFAHGAIFFVRDYDPVA
NKDNVLARMLEHKEALISHLSWVSLFLGFHTLGLYVHNDV
VVAFGTPEKQILIEPVFAQWIQATSGKALYGFDVLLSNPD
SIASTTGAAWLPGWLDAINSGTNSLFLTIGPGDFLVHHAI
ALGLHTTALILIKGALDARGSKLMPDKKDFGYSFPCDGPG
RGGTCDISAWDAFYLAMFWMLNTLGWLTFYWHWKHLGVWS
GNVAQFNENSTYLMGWFRDYLWANSAQLINGYNPYGVNNL
SVWAWMFLFGHLVWATGFMFLISWRGYWQELIETIVWAHE
RTPLANLVRWKDKPVALSIVQARLVGLAHFTVGYVLTYAA
FLIASTAGKFG
Description (1)  Photosystem I P700 chlorophyll a apoprotein A1 (E.C.1.97.1.12), Photosystem I P700 chlorophyll a apoprotein A2 (E.C.1.97.1.12), Photosystem I iron-sulfur center (E.C.1.97.1.12), Photosystem I reaction center subunit II, Photosystem I reaction center subunit IV, Photosystem I reaction center subunit III, Photosystem I reaction center subunit VIII, Photosystem I reaction center subunit IX, Photosystem I reaction center subunit PsaK 2, Photosystem I reaction center subunit XI, Photosystem I reaction center subunit XII


Functional site

1) chain B
residue 617
type
ligand
sequence F
description binding site for residue CLA A 1011
source : AC1

2) chain B
residue 621
type
ligand
sequence L
description binding site for residue CLA A 1011
source : AC1

3) chain B
residue 622
type
ligand
sequence W
description binding site for residue CLA A 1011
source : AC1

4) chain B
residue 578
type
ligand
sequence F
description binding site for residue CLA A 1012
source : AC2

5) chain B
residue 579
type
ligand
sequence W
description binding site for residue CLA A 1012
source : AC2

6) chain B
residue 582
type
ligand
sequence N
description binding site for residue CLA A 1012
source : AC2

7) chain B
residue 586
type
ligand
sequence W
description binding site for residue CLA A 1012
source : AC2

8) chain B
residue 613
type
ligand
sequence L
description binding site for residue CLA A 1012
source : AC2

9) chain B
residue 617
type
ligand
sequence F
description binding site for residue CLA A 1012
source : AC2

10) chain B
residue 710
type
ligand
sequence F
description binding site for residue CLA A 1012
source : AC2

11) chain B
residue 421
type
ligand
sequence S
description binding site for residue CLA A 1013
source : AC3

12) chain B
residue 424
type
ligand
sequence S
description binding site for residue CLA A 1013
source : AC3

13) chain B
residue 425
type
ligand
sequence L
description binding site for residue CLA A 1013
source : AC3

14) chain B
residue 428
type
ligand
sequence G
description binding site for residue CLA A 1013
source : AC3

15) chain B
residue 429
type
ligand
sequence F
description binding site for residue CLA A 1013
source : AC3

16) chain B
residue 529
type
ligand
sequence L
description binding site for residue CLA A 1013
source : AC3

17) chain B
residue 530
type
ligand
sequence I
description binding site for residue CLA A 1013
source : AC3

18) chain B
residue 578
type
ligand
sequence F
description binding site for residue CLA A 1013
source : AC3

19) chain B
residue 579
type
ligand
sequence W
description binding site for residue CLA A 1013
source : AC3

20) chain B
residue 418
type
ligand
sequence S
description binding site for residue CLA A 1138
source : AG2

21) chain B
residue 421
type
ligand
sequence S
description binding site for residue CLA A 1138
source : AG2

22) chain B
residue 422
type
ligand
sequence W
description binding site for residue CLA A 1138
source : AG2

23) chain B
residue 556
type
ligand
sequence C
description binding site for residue SF4 A 3001
source : AG7

24) chain B
residue 558
type
ligand
sequence G
description binding site for residue SF4 A 3001
source : AG7

25) chain B
residue 559
type
ligand
sequence P
description binding site for residue SF4 A 3001
source : AG7

26) chain B
residue 565
type
ligand
sequence C
description binding site for residue SF4 A 3001
source : AG7

27) chain B
residue 664
type
ligand
sequence W
description binding site for residue SF4 A 3001
source : AG7

28) chain B
residue 678
type
ligand
sequence A
description binding site for residue CLA A 1130
source : AH7

29) chain B
residue 682
type
ligand
sequence T
description binding site for residue CLA A 1130
source : AH7

30) chain B
residue 683
type
ligand
sequence P
description binding site for residue CLA A 1130
source : AH7

31) chain B
residue 675
type
ligand
sequence I
description binding site for residue CLA B 1237
source : AH9

32) chain B
residue 678
type
ligand
sequence A
description binding site for residue CLA B 1237
source : AH9

33) chain B
residue 679
type
ligand
sequence H
description binding site for residue CLA B 1237
source : AH9

34) chain B
residue 682
type
ligand
sequence T
description binding site for residue CLA B 1237
source : AH9

35) chain B
residue 432
type
ligand
sequence L
description binding site for residue 45D B 4011
source : AI1

36) chain B
residue 436
type
ligand
sequence V
description binding site for residue 45D B 4011
source : AI1

37) chain B
residue 431
type
ligand
sequence T
description binding site for residue CLA B 1021
source : AI3

38) chain B
residue 432
type
ligand
sequence L
description binding site for residue CLA B 1021
source : AI3

39) chain B
residue 435
type
ligand
sequence Y
description binding site for residue CLA B 1021
source : AI3

40) chain B
residue 516
type
ligand
sequence V
description binding site for residue CLA B 1021
source : AI3

41) chain B
residue 586
type
ligand
sequence W
description binding site for residue CLA B 1021
source : AI3

42) chain B
residue 589
type
ligand
sequence F
description binding site for residue CLA B 1021
source : AI3

43) chain B
residue 613
type
ligand
sequence L
description binding site for residue CLA B 1021
source : AI3

44) chain B
residue 616
type
ligand
sequence W
description binding site for residue CLA B 1021
source : AI3

45) chain B
residue 621
type
ligand
sequence L
description binding site for residue CLA B 1021
source : AI3

46) chain B
residue 625
type
ligand
sequence S
description binding site for residue CLA B 1021
source : AI3

47) chain B
residue 629
type
ligand
sequence I
description binding site for residue CLA B 1021
source : AI3

48) chain B
residue 647
type
ligand
sequence F
description binding site for residue CLA B 1021
source : AI3

49) chain B
residue 651
type
ligand
sequence H
description binding site for residue CLA B 1021
source : AI3

50) chain B
residue 654
type
ligand
sequence W
description binding site for residue CLA B 1021
source : AI3

51) chain B
residue 714
type
ligand
sequence Y
description binding site for residue CLA B 1021
source : AI3

52) chain B
residue 717
type
ligand
sequence T
description binding site for residue CLA B 1021
source : AI3

53) chain B
residue 718
type
ligand
sequence Y
description binding site for residue CLA B 1021
source : AI3

54) chain B
residue 721
type
ligand
sequence F
description binding site for residue CLA B 1021
source : AI3

55) chain B
residue 645
type
ligand
sequence W
description binding site for residue CLA B 1022
source : AI4

56) chain B
residue 648
type
ligand
sequence L
description binding site for residue CLA B 1022
source : AI4

57) chain B
residue 649
type
ligand
sequence F
description binding site for residue CLA B 1022
source : AI4

58) chain B
residue 651
type
ligand
sequence H
description binding site for residue CLA B 1022
source : AI4

59) chain B
residue 652
type
ligand
sequence L
description binding site for residue CLA B 1022
source : AI4

60) chain B
residue 654
type
ligand
sequence W
description binding site for residue CLA B 1022
source : AI4

61) chain B
residue 655
type
ligand
sequence A
description binding site for residue CLA B 1022
source : AI4

62) chain B
residue 652
type
ligand
sequence L
description binding site for residue CLA B 1023
source : AI5

63) chain B
residue 655
type
ligand
sequence A
description binding site for residue CLA B 1023
source : AI5

64) chain B
residue 656
type
ligand
sequence T
description binding site for residue CLA B 1023
source : AI5

65) chain B
residue 658
type
ligand
sequence F
description binding site for residue CLA B 1023
source : AI5

66) chain B
residue 659
type
ligand
sequence M
description binding site for residue CLA B 1023
source : AI5

67) chain B
residue 667
type
ligand
sequence Y
description binding site for residue CLA B 1023
source : AI5

68) chain B
residue 668
type
ligand
sequence W
description binding site for residue CLA B 1023
source : AI5

69) chain B
residue 671
type
ligand
sequence L
description binding site for residue CLA B 1023
source : AI5

70) chain B
residue 8
type
ligand
sequence F
description binding site for residue CLA B 1201
source : AI6

71) chain B
residue 25
type
ligand
sequence I
description binding site for residue CLA B 1201
source : AI6

72) chain B
residue 28
type
ligand
sequence A
description binding site for residue CLA B 1201
source : AI6

73) chain B
residue 29
type
ligand
sequence H
description binding site for residue CLA B 1201
source : AI6

74) chain B
residue 53
type
ligand
sequence H
description binding site for residue CLA B 1201
source : AI6

75) chain B
residue 29
type
ligand
sequence H
description binding site for residue CLA B 1202
source : AI7

76) chain B
residue 31
type
ligand
sequence F
description binding site for residue CLA B 1202
source : AI7

77) chain B
residue 46
type
ligand
sequence I
description binding site for residue CLA B 1202
source : AI7

78) chain B
residue 49
type
ligand
sequence S
description binding site for residue CLA B 1202
source : AI7

79) chain B
residue 50
type
ligand
sequence H
description binding site for residue CLA B 1202
source : AI7

80) chain B
residue 53
type
ligand
sequence H
description binding site for residue CLA B 1202
source : AI7

81) chain B
residue 54
type
ligand
sequence I
description binding site for residue CLA B 1202
source : AI7

82) chain B
residue 178
type
ligand
sequence H
description binding site for residue CLA B 1202
source : AI7

83) chain B
residue 182
type
ligand
sequence L
description binding site for residue CLA B 1202
source : AI7

84) chain B
residue 328
type
ligand
sequence L
description binding site for residue CLA B 1202
source : AI7

85) chain B
residue 332
type
ligand
sequence L
description binding site for residue CLA B 1202
source : AI7

86) chain B
residue 335
type
ligand
sequence A
description binding site for residue CLA B 1202
source : AI7

87) chain B
residue 29
type
ligand
sequence H
description binding site for residue CLA B 1203
source : AI8

88) chain B
residue 53
type
ligand
sequence H
description binding site for residue CLA B 1203
source : AI8

89) chain B
residue 57
type
ligand
sequence I
description binding site for residue CLA B 1203
source : AI8

90) chain B
residue 60
type
ligand
sequence W
description binding site for residue CLA B 1203
source : AI8

91) chain B
residue 339
type
ligand
sequence L
description binding site for residue CLA B 1203
source : AI8

92) chain B
residue 59
type
ligand
sequence L
description binding site for residue CLA B 1204
source : AI9

93) chain B
residue 60
type
ligand
sequence W
description binding site for residue CLA B 1204
source : AI9

94) chain B
residue 62
type
ligand
sequence S
description binding site for residue CLA B 1204
source : AI9

95) chain B
residue 63
type
ligand
sequence G
description binding site for residue CLA B 1204
source : AI9

96) chain B
residue 66
type
ligand
sequence F
description binding site for residue CLA B 1204
source : AI9

97) chain B
residue 67
type
ligand
sequence H
description binding site for residue CLA B 1204
source : AI9

98) chain B
residue 70
type
ligand
sequence W
description binding site for residue CLA B 1204
source : AI9

99) chain B
residue 71
type
ligand
sequence Q
description binding site for residue CLA B 1204
source : AI9

100) chain B
residue 88
type
ligand
sequence A
description binding site for residue CLA B 1205
source : AJ1

101) chain B
residue 89
type
ligand
sequence H
description binding site for residue CLA B 1205
source : AJ1

102) chain B
residue 115
type
ligand
sequence I
description binding site for residue CLA B 1205
source : AJ1

103) chain B
residue 117
type
ligand
sequence Y
description binding site for residue CLA B 1205
source : AJ1

104) chain B
residue 118
type
ligand
sequence S
description binding site for residue CLA B 1205
source : AJ1

105) chain B
residue 643
type
ligand
sequence W
description binding site for residue CLA B 1205
source : AJ1

106) chain B
residue 89
type
ligand
sequence H
description binding site for residue CLA B 1206
source : AJ2

107) chain B
residue 91
type
ligand
sequence I
description binding site for residue CLA B 1206
source : AJ2

108) chain B
residue 92
type
ligand
sequence W
description binding site for residue CLA B 1206
source : AJ2

109) chain B
residue 93
type
ligand
sequence D
description binding site for residue CLA B 1206
source : AJ2

110) chain B
residue 95
type
ligand
sequence H
description binding site for residue CLA B 1206
source : AJ2

111) chain B
residue 96
type
ligand
sequence F
description binding site for residue CLA B 1206
source : AJ2

112) chain B
residue 114
type
ligand
sequence N
description binding site for residue CLA B 1206
source : AJ2

113) chain B
residue 642
type
ligand
sequence V
description binding site for residue CLA B 1206
source : AJ2

114) chain B
residue 95
type
ligand
sequence H
description binding site for residue CLA B 1207
source : AJ3

115) chain B
residue 47
type
ligand
sequence F
description binding site for residue CLA B 1208
source : AJ4

116) chain B
residue 51
type
ligand
sequence F
description binding site for residue CLA B 1208
source : AJ4

117) chain B
residue 148
type
ligand
sequence L
description binding site for residue CLA B 1208
source : AJ4

118) chain B
residue 149
type
ligand
sequence F
description binding site for residue CLA B 1208
source : AJ4

119) chain B
residue 152
type
ligand
sequence A
description binding site for residue CLA B 1208
source : AJ4

120) chain B
residue 156
type
ligand
sequence H
description binding site for residue CLA B 1208
source : AJ4

121) chain B
residue 160
type
ligand
sequence K
description binding site for residue CLA B 1208
source : AJ4

122) chain B
residue 161
type
ligand
sequence F
description binding site for residue CLA B 1208
source : AJ4

123) chain B
residue 167
type
ligand
sequence W
description binding site for residue CLA B 1208
source : AJ4

124) chain B
residue 167
type
ligand
sequence W
description binding site for residue CLA B 1209
source : AJ5

125) chain B
residue 173
type
ligand
sequence S
description binding site for residue CLA B 1209
source : AJ5

126) chain B
residue 177
type
ligand
sequence H
description binding site for residue CLA B 1209
source : AJ5

127) chain B
residue 294
type
ligand
sequence N
description binding site for residue CLA B 1209
source : AJ5

128) chain B
residue 295
type
ligand
sequence W
description binding site for residue CLA B 1209
source : AJ5

129) chain B
residue 47
type
ligand
sequence F
description binding site for residue CLA B 1210
source : AJ6

130) chain B
residue 50
type
ligand
sequence H
description binding site for residue CLA B 1210
source : AJ6

131) chain B
residue 51
type
ligand
sequence F
description binding site for residue CLA B 1210
source : AJ6

132) chain B
residue 54
type
ligand
sequence I
description binding site for residue CLA B 1210
source : AJ6

133) chain B
residue 167
type
ligand
sequence W
description binding site for residue CLA B 1210
source : AJ6

134) chain B
residue 174
type
ligand
sequence R
description binding site for residue CLA B 1210
source : AJ6

135) chain B
residue 177
type
ligand
sequence H
description binding site for residue CLA B 1210
source : AJ6

136) chain B
residue 178
type
ligand
sequence H
description binding site for residue CLA B 1210
source : AJ6

137) chain B
residue 181
type
ligand
sequence G
description binding site for residue CLA B 1210
source : AJ6

138) chain B
residue 182
type
ligand
sequence L
description binding site for residue CLA B 1210
source : AJ6

139) chain B
residue 129
type
ligand
sequence M
description binding site for residue CLA B 1211
source : AJ7

140) chain B
residue 134
type
ligand
sequence E
description binding site for residue CLA B 1211
source : AJ7

141) chain B
residue 137
type
ligand
sequence S
description binding site for residue CLA B 1211
source : AJ7

142) chain B
residue 138
type
ligand
sequence G
description binding site for residue CLA B 1211
source : AJ7

143) chain B
residue 141
type
ligand
sequence F
description binding site for residue CLA B 1211
source : AJ7

144) chain B
residue 186
type
ligand
sequence S
description binding site for residue CLA B 1211
source : AJ7

145) chain B
residue 189
type
ligand
sequence A
description binding site for residue CLA B 1211
source : AJ7

146) chain B
residue 190
type
ligand
sequence W
description binding site for residue CLA B 1211
source : AJ7

147) chain B
residue 193
type
ligand
sequence H
description binding site for residue CLA B 1211
source : AJ7

148) chain B
residue 196
type
ligand
sequence H
description binding site for residue CLA B 1211
source : AJ7

149) chain B
residue 197
type
ligand
sequence V
description binding site for residue CLA B 1211
source : AJ7

150) chain B
residue 208
type
ligand
sequence G
description binding site for residue CLA B 1211
source : AJ7

151) chain B
residue 209
type
ligand
sequence W
description binding site for residue CLA B 1211
source : AJ7

152) chain B
residue 212
type
ligand
sequence F
description binding site for residue CLA B 1211
source : AJ7

153) chain B
residue 188
type
ligand
sequence L
description binding site for residue CLA B 1212
source : AJ8

154) chain B
residue 189
type
ligand
sequence A
description binding site for residue CLA B 1212
source : AJ8

155) chain B
residue 195
type
ligand
sequence V
description binding site for residue CLA B 1212
source : AJ8

156) chain B
residue 196
type
ligand
sequence H
description binding site for residue CLA B 1212
source : AJ8

157) chain B
residue 213
type
ligand
sequence L
description binding site for residue CLA B 1212
source : AJ8

158) chain B
residue 214
type
ligand
sequence S
description binding site for residue CLA B 1212
source : AJ8

159) chain B
residue 216
type
ligand
sequence P
description binding site for residue CLA B 1212
source : AJ8

160) chain B
residue 217
type
ligand
sequence P
description binding site for residue CLA B 1212
source : AJ8

161) chain B
residue 221
type
ligand
sequence G
description binding site for residue CLA B 1212
source : AJ8

162) chain B
residue 222
type
ligand
sequence L
description binding site for residue CLA B 1212
source : AJ8

163) chain B
residue 230
type
ligand
sequence W
description binding site for residue CLA B 1213
source : AJ9

164) chain B
residue 255
type
ligand
sequence L
description binding site for residue CLA B 1213
source : AJ9

165) chain B
residue 256
type
ligand
sequence T
description binding site for residue CLA B 1213
source : AJ9

166) chain B
residue 257
type
ligand
sequence F
description binding site for residue CLA B 1213
source : AJ9

167) chain B
residue 275
type
ligand
sequence H
description binding site for residue CLA B 1213
source : AJ9

168) chain B
residue 278
type
ligand
sequence L
description binding site for residue CLA B 1213
source : AJ9

169) chain B
residue 279
type
ligand
sequence A
description binding site for residue CLA B 1213
source : AJ9

170) chain B
residue 489
type
ligand
sequence A
description binding site for residue CLA B 1213
source : AJ9

171) chain B
residue 257
type
ligand
sequence F
description binding site for residue CLA B 1214
source : AK1

172) chain B
residue 272
type
ligand
sequence D
description binding site for residue CLA B 1214
source : AK1

173) chain B
residue 273
type
ligand
sequence I
description binding site for residue CLA B 1214
source : AK1

174) chain B
residue 275
type
ligand
sequence H
description binding site for residue CLA B 1214
source : AK1

175) chain B
residue 276
type
ligand
sequence H
description binding site for residue CLA B 1214
source : AK1

176) chain B
residue 349
type
ligand
sequence H
description binding site for residue CLA B 1214
source : AK1

177) chain B
residue 353
type
ligand
sequence L
description binding site for residue CLA B 1214
source : AK1

178) chain B
residue 494
type
ligand
sequence W
description binding site for residue CLA B 1214
source : AK1

179) chain B
residue 123
type
ligand
sequence W
description binding site for residue CLA B 1215
source : AK2

180) chain B
residue 183
type
ligand
sequence F
description binding site for residue CLA B 1215
source : AK2

181) chain B
residue 186
type
ligand
sequence S
description binding site for residue CLA B 1215
source : AK2

182) chain B
residue 190
type
ligand
sequence W
description binding site for residue CLA B 1215
source : AK2

183) chain B
residue 276
type
ligand
sequence H
description binding site for residue CLA B 1215
source : AK2

184) chain B
residue 277
type
ligand
sequence H
description binding site for residue CLA B 1215
source : AK2

185) chain B
residue 280
type
ligand
sequence I
description binding site for residue CLA B 1215
source : AK2

186) chain B
residue 284
type
ligand
sequence F
description binding site for residue CLA B 1215
source : AK2

187) chain B
residue 346
type
ligand
sequence V
description binding site for residue CLA B 1215
source : AK2

188) chain B
residue 350
type
ligand
sequence M
description binding site for residue CLA B 1215
source : AK2

189) chain B
residue 355
type
ligand
sequence S
description binding site for residue CLA B 1215
source : AK2

190) chain B
residue 356
type
ligand
sequence Y
description binding site for residue CLA B 1215
source : AK2

191) chain B
residue 179
type
ligand
sequence L
description binding site for residue CLA B 1216
source : AK3

192) chain B
residue 283
type
ligand
sequence I
description binding site for residue CLA B 1216
source : AK3

193) chain B
residue 284
type
ligand
sequence F
description binding site for residue CLA B 1216
source : AK3

194) chain B
residue 287
type
ligand
sequence A
description binding site for residue CLA B 1216
source : AK3

195) chain B
residue 290
type
ligand
sequence M
description binding site for residue CLA B 1216
source : AK3

196) chain B
residue 291
type
ligand
sequence Y
description binding site for residue CLA B 1216
source : AK3

197) chain B
residue 301
type
ligand
sequence I
description binding site for residue CLA B 1216
source : AK3

198) chain B
residue 304
type
ligand
sequence I
description binding site for residue CLA B 1216
source : AK3

199) chain B
residue 176
type
ligand
sequence N
description binding site for residue CLA B 1217
source : AK4

200) chain B
residue 180
type
ligand
sequence A
description binding site for residue CLA B 1217
source : AK4

201) chain B
residue 289
type
ligand
sequence H
description binding site for residue CLA B 1217
source : AK4

202) chain B
residue 293
type
ligand
sequence T
description binding site for residue CLA B 1217
source : AK4

203) chain B
residue 295
type
ligand
sequence W
description binding site for residue CLA B 1217
source : AK4

204) chain B
residue 297
type
ligand
sequence I
description binding site for residue CLA B 1217
source : AK4

205) chain B
residue 286
type
ligand
sequence I
description binding site for residue CLA B 1218
source : AK5

206) chain B
residue 289
type
ligand
sequence H
description binding site for residue CLA B 1218
source : AK5

207) chain B
residue 290
type
ligand
sequence M
description binding site for residue CLA B 1218
source : AK5

208) chain B
residue 297
type
ligand
sequence I
description binding site for residue CLA B 1218
source : AK5

209) chain B
residue 298
type
ligand
sequence G
description binding site for residue CLA B 1218
source : AK5

210) chain B
residue 299
type
ligand
sequence H
description binding site for residue CLA B 1218
source : AK5

211) chain B
residue 299
type
ligand
sequence H
description binding site for residue CLA B 1219
source : AK6

212) chain B
residue 304
type
ligand
sequence I
description binding site for residue CLA B 1219
source : AK6

213) chain B
residue 307
type
ligand
sequence A
description binding site for residue CLA B 1219
source : AK6

214) chain B
residue 308
type
ligand
sequence H
description binding site for residue CLA B 1219
source : AK6

215) chain B
residue 304
type
ligand
sequence I
description binding site for residue CLA B 1220
source : AK7

216) chain B
residue 305
type
ligand
sequence L
description binding site for residue CLA B 1220
source : AK7

217) chain B
residue 308
type
ligand
sequence H
description binding site for residue CLA B 1220
source : AK7

218) chain B
residue 317
type
ligand
sequence H
description binding site for residue CLA B 1220
source : AK7

219) chain B
residue 324
type
ligand
sequence I
description binding site for residue CLA B 1220
source : AK7

220) chain B
residue 405
type
ligand
sequence V
description binding site for residue CLA B 1220
source : AK7

221) chain B
residue 171
type
ligand
sequence A
description binding site for residue CLA B 1221
source : AK8

222) chain B
residue 174
type
ligand
sequence R
description binding site for residue CLA B 1221
source : AK8

223) chain B
residue 175
type
ligand
sequence L
description binding site for residue CLA B 1221
source : AK8

224) chain B
residue 178
type
ligand
sequence H
description binding site for residue CLA B 1221
source : AK8

225) chain B
residue 305
type
ligand
sequence L
description binding site for residue CLA B 1221
source : AK8

226) chain B
residue 344
type
ligand
sequence S
description binding site for residue CLA B 1222
source : AK9

227) chain B
residue 348
type
ligand
sequence Q
description binding site for residue CLA B 1222
source : AK9

228) chain B
residue 374
type
ligand
sequence Q
description binding site for residue CLA B 1222
source : AK9

229) chain B
residue 378
type
ligand
sequence G
description binding site for residue CLA B 1222
source : AK9

230) chain B
residue 381
type
ligand
sequence M
description binding site for residue CLA B 1222
source : AK9

231) chain B
residue 382
type
ligand
sequence V
description binding site for residue CLA B 1222
source : AK9

232) chain B
residue 385
type
ligand
sequence F
description binding site for residue CLA B 1222
source : AK9

233) chain B
residue 524
type
ligand
sequence L
description binding site for residue CLA B 1222
source : AK9

234) chain B
residue 531
type
ligand
sequence L
description binding site for residue CLA B 1222
source : AK9

235) chain B
residue 580
type
ligand
sequence M
description binding site for residue CLA B 1222
source : AK9

236) chain B
residue 341
type
ligand
sequence V
description binding site for residue CLA B 1223
source : AL1

237) chain B
residue 345
type
ligand
sequence L
description binding site for residue CLA B 1223
source : AL1

238) chain B
residue 348
type
ligand
sequence Q
description binding site for residue CLA B 1223
source : AL1

239) chain B
residue 349
type
ligand
sequence H
description binding site for residue CLA B 1223
source : AL1

240) chain B
residue 351
type
ligand
sequence Y
description binding site for residue CLA B 1223
source : AL1

241) chain B
residue 352
type
ligand
sequence S
description binding site for residue CLA B 1223
source : AL1

242) chain B
residue 505
type
ligand
sequence L
description binding site for residue CLA B 1223
source : AL1

243) chain B
residue 60
type
ligand
sequence W
description binding site for residue CLA B 1224
source : AL2

244) chain B
residue 117
type
ligand
sequence Y
description binding site for residue CLA B 1224
source : AL2

245) chain B
residue 368
type
ligand
sequence A
description binding site for residue CLA B 1224
source : AL2

246) chain B
residue 371
type
ligand
sequence T
description binding site for residue CLA B 1224
source : AL2

247) chain B
residue 372
type
ligand
sequence H
description binding site for residue CLA B 1224
source : AL2

248) chain B
residue 375
type
ligand
sequence Y
description binding site for residue CLA B 1224
source : AL2

249) chain B
residue 379
type
ligand
sequence F
description binding site for residue CLA B 1224
source : AL2

250) chain B
residue 719
type
ligand
sequence A
description binding site for residue CLA B 1224
source : AL2

251) chain B
residue 60
type
ligand
sequence W
description binding site for residue CLA B 1225
source : AL3

252) chain B
residue 61
type
ligand
sequence T
description binding site for residue CLA B 1225
source : AL3

253) chain B
residue 119
type
ligand
sequence G
description binding site for residue CLA B 1225
source : AL3

254) chain B
residue 343
type
ligand
sequence T
description binding site for residue CLA B 1225
source : AL3

255) chain B
residue 350
type
ligand
sequence M
description binding site for residue CLA B 1225
source : AL3

256) chain B
residue 356
type
ligand
sequence Y
description binding site for residue CLA B 1225
source : AL3

257) chain B
residue 372
type
ligand
sequence H
description binding site for residue CLA B 1225
source : AL3

258) chain B
residue 373
type
ligand
sequence H
description binding site for residue CLA B 1225
source : AL3

259) chain B
residue 26
type
ligand
sequence A
description binding site for residue CLA B 1226
source : AL4

260) chain B
residue 29
type
ligand
sequence H
description binding site for residue CLA B 1226
source : AL4

261) chain B
residue 30
type
ligand
sequence D
description binding site for residue CLA B 1226
source : AL4

262) chain B
residue 332
type
ligand
sequence L
description binding site for residue CLA B 1226
source : AL4

263) chain B
residue 379
type
ligand
sequence F
description binding site for residue CLA B 1226
source : AL4

264) chain B
residue 383
type
ligand
sequence G
description binding site for residue CLA B 1226
source : AL4

265) chain B
residue 387
type
ligand
sequence H
description binding site for residue CLA B 1226
source : AL4

266) chain B
residue 390
type
ligand
sequence I
description binding site for residue CLA B 1226
source : AL4

267) chain B
residue 394
type
ligand
sequence R
description binding site for residue CLA B 1226
source : AL4

268) chain B
residue 552
type
ligand
sequence Y
description binding site for residue CLA B 1226
source : AL4

269) chain B
residue 570
type
ligand
sequence W
description binding site for residue CLA B 1226
source : AL4

270) chain B
residue 573
type
ligand
sequence F
description binding site for residue CLA B 1226
source : AL4

271) chain B
residue 312
type
ligand
sequence L
description binding site for residue CLA B 1227
source : AL5

272) chain B
residue 313
type
ligand
sequence T
description binding site for residue CLA B 1227
source : AL5

273) chain B
residue 408
type
ligand
sequence R
description binding site for residue CLA B 1227
source : AL5

274) chain B
residue 409
type
ligand
sequence M
description binding site for residue CLA B 1227
source : AL5

275) chain B
residue 412
type
ligand
sequence H
description binding site for residue CLA B 1227
source : AL5

276) chain B
residue 416
type
ligand
sequence L
description binding site for residue CLA B 1227
source : AL5

277) chain B
residue 419
type
ligand
sequence H
description binding site for residue CLA B 1227
source : AL5

278) chain B
residue 415
type
ligand
sequence A
description binding site for residue CLA B 1228
source : AL6

279) chain B
residue 419
type
ligand
sequence H
description binding site for residue CLA B 1228
source : AL6

280) chain B
residue 422
type
ligand
sequence W
description binding site for residue CLA B 1228
source : AL6

281) chain B
residue 422
type
ligand
sequence W
description binding site for residue CLA B 1229
source : AL7

282) chain B
residue 425
type
ligand
sequence L
description binding site for residue CLA B 1229
source : AL7

283) chain B
residue 426
type
ligand
sequence F
description binding site for residue CLA B 1229
source : AL7

284) chain B
residue 430
type
ligand
sequence H
description binding site for residue CLA B 1229
source : AL7

285) chain B
residue 433
type
ligand
sequence G
description binding site for residue CLA B 1230
source : AL8

286) chain B
residue 437
type
ligand
sequence H
description binding site for residue CLA B 1230
source : AL8

287) chain B
residue 440
type
ligand
sequence V
description binding site for residue CLA B 1230
source : AL8

288) chain B
residue 449
type
ligand
sequence K
description binding site for residue CLA B 1230
source : AL8

289) chain B
residue 451
type
ligand
sequence I
description binding site for residue CLA B 1230
source : AL8

290) chain B
residue 460
type
ligand
sequence W
description binding site for residue CLA B 1231
source : AL9

291) chain B
residue 461
type
ligand
sequence I
description binding site for residue CLA B 1231
source : AL9

292) chain B
residue 465
type
ligand
sequence S
description binding site for residue CLA B 1231
source : AL9

293) chain B
residue 475
type
ligand
sequence L
description binding site for residue CLA B 1231
source : AL9

294) chain B
residue 476
type
ligand
sequence L
description binding site for residue CLA B 1231
source : AL9

295) chain B
residue 490
type
ligand
sequence W
description binding site for residue CLA B 1231
source : AL9

296) chain B
residue 475
type
ligand
sequence L
description binding site for residue CLA B 1232
source : AM1

297) chain B
residue 482
type
ligand
sequence I
description binding site for residue CLA B 1232
source : AM1

298) chain B
residue 486
type
ligand
sequence T
description binding site for residue CLA B 1232
source : AM1

299) chain B
residue 490
type
ligand
sequence W
description binding site for residue CLA B 1232
source : AM1

300) chain B
residue 348
type
ligand
sequence Q
description binding site for residue CLA B 1234
source : AM2

301) chain B
residue 351
type
ligand
sequence Y
description binding site for residue CLA B 1234
source : AM2

302) chain B
residue 370
type
ligand
sequence Y
description binding site for residue CLA B 1234
source : AM2

303) chain B
residue 457
type
ligand
sequence F
description binding site for residue CLA B 1234
source : AM2

304) chain B
residue 458
type
ligand
sequence A
description binding site for residue CLA B 1234
source : AM2

305) chain B
residue 461
type
ligand
sequence I
description binding site for residue CLA B 1234
source : AM2

306) chain B
residue 462
type
ligand
sequence Q
description binding site for residue CLA B 1234
source : AM2

307) chain B
residue 506
type
ligand
sequence F
description binding site for residue CLA B 1234
source : AM2

308) chain B
residue 507
type
ligand
sequence L
description binding site for residue CLA B 1234
source : AM2

309) chain B
residue 517
type
ligand
sequence H
description binding site for residue CLA B 1234
source : AM2

310) chain B
residue 520
type
ligand
sequence I
description binding site for residue CLA B 1234
source : AM2

311) chain B
residue 587
type
ligand
sequence L
description binding site for residue CLA B 1234
source : AM2

312) chain B
residue 590
type
ligand
sequence Y
description binding site for residue CLA B 1234
source : AM2

313) chain B
residue 591
type
ligand
sequence W
description binding site for residue CLA B 1234
source : AM2

314) chain B
residue 423
type
ligand
sequence V
description binding site for residue CLA B 1235
source : AM3

315) chain B
residue 426
type
ligand
sequence F
description binding site for residue CLA B 1235
source : AM3

316) chain B
residue 454
type
ligand
sequence E
description binding site for residue CLA B 1235
source : AM3

317) chain B
residue 455
type
ligand
sequence P
description binding site for residue CLA B 1235
source : AM3

318) chain B
residue 456
type
ligand
sequence V
description binding site for residue CLA B 1235
source : AM3

319) chain B
residue 457
type
ligand
sequence F
description binding site for residue CLA B 1235
source : AM3

320) chain B
residue 458
type
ligand
sequence A
description binding site for residue CLA B 1235
source : AM3

321) chain B
residue 514
type
ligand
sequence F
description binding site for residue CLA B 1235
source : AM3

322) chain B
residue 517
type
ligand
sequence H
description binding site for residue CLA B 1235
source : AM3

323) chain B
residue 518
type
ligand
sequence H
description binding site for residue CLA B 1235
source : AM3

324) chain B
residue 416
type
ligand
sequence L
description binding site for residue CLA B 1236
source : AM4

325) chain B
residue 420
type
ligand
sequence L
description binding site for residue CLA B 1236
source : AM4

326) chain B
residue 422
type
ligand
sequence W
description binding site for residue CLA B 1236
source : AM4

327) chain B
residue 521
type
ligand
sequence A
description binding site for residue CLA B 1236
source : AM4

328) chain B
residue 524
type
ligand
sequence L
description binding site for residue CLA B 1236
source : AM4

329) chain B
residue 525
type
ligand
sequence H
description binding site for residue CLA B 1236
source : AM4

330) chain B
residue 532
type
ligand
sequence I
description binding site for residue CLA B 1236
source : AM4

331) chain B
residue 22
type
ligand
sequence W
description binding site for residue CLA B 1239
source : AM5

332) chain B
residue 649
type
ligand
sequence F
description binding site for residue CLA B 1239
source : AM5

333) chain B
residue 652
type
ligand
sequence L
description binding site for residue CLA B 1239
source : AM5

334) chain B
residue 653
type
ligand
sequence V
description binding site for residue CLA B 1239
source : AM5

335) chain B
residue 656
type
ligand
sequence T
description binding site for residue CLA B 1239
source : AM5

336) chain B
residue 659
type
ligand
sequence M
description binding site for residue CLA B 1239
source : AM5

337) chain B
residue 660
type
ligand
sequence F
description binding site for residue CLA B 1239
source : AM5

338) chain B
residue 709
type
ligand
sequence H
description binding site for residue CLA B 1239
source : AM5

339) chain B
residue 308
type
ligand
sequence H
description binding site for residue CLA B 1240
source : AM6

340) chain B
residue 309
type
ligand
sequence K
description binding site for residue CLA B 1240
source : AM6

341) chain B
residue 310
type
ligand
sequence G
description binding site for residue CLA B 1240
source : AM6

342) chain B
residue 311
type
ligand
sequence P
description binding site for residue CLA B 1240
source : AM6

343) chain B
residue 659
type
ligand
sequence M
description binding site for residue PQN B 2002
source : AM7

344) chain B
residue 663
type
ligand
sequence S
description binding site for residue PQN B 2002
source : AM7

345) chain B
residue 664
type
ligand
sequence W
description binding site for residue PQN B 2002
source : AM7

346) chain B
residue 665
type
ligand
sequence R
description binding site for residue PQN B 2002
source : AM7

347) chain B
residue 668
type
ligand
sequence W
description binding site for residue PQN B 2002
source : AM7

348) chain B
residue 696
type
ligand
sequence A
description binding site for residue PQN B 2002
source : AM7

349) chain B
residue 697
type
ligand
sequence L
description binding site for residue PQN B 2002
source : AM7

350) chain B
residue 702
type
ligand
sequence A
description binding site for residue PQN B 2002
source : AM7

351) chain B
residue 188
type
ligand
sequence L
description binding site for residue BCR B 4004
source : AM8

352) chain B
residue 278
type
ligand
sequence L
description binding site for residue BCR B 4004
source : AM8

353) chain B
residue 285
type
ligand
sequence I
description binding site for residue BCR B 4004
source : AM8

354) chain B
residue 289
type
ligand
sequence H
description binding site for residue BCR B 4004
source : AM8

355) chain B
residue 149
type
ligand
sequence F
description binding site for residue BCR B 4005
source : AM9

356) chain B
residue 181
type
ligand
sequence G
description binding site for residue BCR B 4005
source : AM9

357) chain B
residue 182
type
ligand
sequence L
description binding site for residue BCR B 4005
source : AM9

358) chain B
residue 185
type
ligand
sequence V
description binding site for residue BCR B 4005
source : AM9

359) chain B
residue 186
type
ligand
sequence S
description binding site for residue BCR B 4005
source : AM9

360) chain B
residue 65
type
ligand
sequence L
description binding site for residue ECH B 4006
source : AN1

361) chain B
residue 138
type
ligand
sequence G
description binding site for residue ECH B 4006
source : AN1

362) chain B
residue 142
type
ligand
sequence L
description binding site for residue ECH B 4006
source : AN1

363) chain B
residue 213
type
ligand
sequence L
description binding site for residue ECH B 4006
source : AN1

364) chain B
residue 330
type
ligand
sequence F
description binding site for residue BCR B 4010
source : AN2

365) chain B
residue 334
type
ligand
sequence L
description binding site for residue BCR B 4010
source : AN2

366) chain B
residue 337
type
ligand
sequence A
description binding site for residue BCR B 4010
source : AN2

367) chain B
residue 385
type
ligand
sequence F
description binding site for residue BCR B 4010
source : AN2

368) chain B
residue 388
type
ligand
sequence G
description binding site for residue BCR B 4010
source : AN2

369) chain B
residue 391
type
ligand
sequence F
description binding site for residue BCR B 4010
source : AN2

370) chain B
residue 645
type
ligand
sequence W
description binding site for residue BCR B 4017
source : AN3

371) chain B
residue 649
type
ligand
sequence F
description binding site for residue BCR B 4017
source : AN3

372) chain B
residue 668
type
ligand
sequence W
description binding site for residue BCR B 4017
source : AN3

373) chain B
residue 409
type
ligand
sequence M
description binding site for residue BCR B 4018
source : AN4

374) chain B
residue 22
type
ligand
sequence W
description binding site for residue LMG B 5002
source : AN5

375) chain B
residue 23
type
ligand
sequence Y
description binding site for residue LMG B 5002
source : AN5

376) chain B
residue 26
type
ligand
sequence A
description binding site for residue LMG B 5002
source : AN5

377) chain B
residue 553
type
ligand
sequence S
description binding site for residue LMG B 5002
source : AN5

378) chain B
residue 570
type
ligand
sequence W
description binding site for residue LMG B 5002
source : AN5

379) chain B
residue 573
type
ligand
sequence F
description binding site for residue LMG B 5002
source : AN5

380) chain B
residue 701
type
ligand
sequence Q
description binding site for residue LMG B 5002
source : AN5

381) chain B
residue 708
type
ligand
sequence A
description binding site for residue LMG B 5002
source : AN5

382) chain B
residue 712
type
ligand
sequence V
description binding site for residue LMG B 5002
source : AN5

383) chain B
residue 308
type
ligand
sequence H
description binding site for residue LHG B 5004
source : AN6

384) chain B
residue 309
type
ligand
sequence K
description binding site for residue LHG B 5004
source : AN6

385) chain B
residue 310
type
ligand
sequence G
description binding site for residue LHG B 5004
source : AN6

386) chain B
residue 311
type
ligand
sequence P
description binding site for residue LHG B 5004
source : AN6

387) chain B
residue 312
type
ligand
sequence L
description binding site for residue LHG B 5004
source : AN6

388) chain B
residue 313
type
ligand
sequence T
description binding site for residue LHG B 5004
source : AN6

389) chain B
residue 316
type
ligand
sequence G
description binding site for residue LHG B 5004
source : AN6

390) chain B
residue 317
type
ligand
sequence H
description binding site for residue LHG B 5004
source : AN6

391) chain B
residue 405
type
ligand
sequence V
description binding site for residue LHG B 5004
source : AN6

392) chain B
residue 286
type
ligand
sequence I
description binding site for residue LMG B 5005
source : AN7

393) chain B
residue 480
type
ligand
sequence D
description binding site for residue LHG B 5006
source : AN8

394) chain B
residue 481
type
ligand
sequence S
description binding site for residue LHG B 5006
source : AN8

395) chain B
residue 482
type
ligand
sequence I
description binding site for residue LHG B 5006
source : AN8

396) chain B
residue 483
type
ligand
sequence A
description binding site for residue LHG B 5006
source : AN8

397) chain B
residue 155
type
ligand
sequence L
description binding site for residue SQD B 5008
source : AN9

398) chain B
residue 158
type
ligand
sequence Q
description binding site for residue SQD B 5008
source : AN9

399) chain B
residue 160
type
ligand
sequence K
description binding site for residue SQD B 5008
source : AN9

400) chain B
residue 128
type
ligand
sequence G
description binding site for residue CA B 6001
source : AO1

401) chain B
residue 134
type
ligand
sequence E
description binding site for residue CA B 6001
source : AO1

402) chain B
residue 201
type
ligand
sequence E
description binding site for residue CA B 6001
source : AO1

403) chain B
residue 206
type
ligand
sequence H
description binding site for residue CA B 6001
source : AO1

404) chain B
residue 676
type
ligand
sequence V
description binding site for residue CLA B 1238
source : AO2

405) chain B
residue 679
type
ligand
sequence H
description binding site for residue CLA B 1238
source : AO2

406) chain B
residue 688
type
ligand
sequence V
description binding site for residue CLA B 1238
source : AO2

407) chain B
residue 689
type
ligand
sequence R
description binding site for residue CLA B 1238
source : AO2

408) chain B
residue 690
type
ligand
sequence W
description binding site for residue CLA B 1238
source : AO2

409) chain B
residue 691
type
ligand
sequence K
description binding site for residue CLA B 1238
source : AO2

410) chain B
residue 692
type
ligand
sequence D
description binding site for residue CLA B 1238
source : AO2

411) chain B
residue 694
type
ligand
sequence P
description binding site for residue CLA B 1238
source : AO2

412) chain B
residue 396
type
ligand
sequence Y
description binding site for residue SQD F 5001
source : AO5

413) chain B
residue 407
type
ligand
sequence A
description binding site for residue SQD F 5001
source : AO5

414) chain B
residue 411
type
ligand
sequence E
description binding site for residue SQD F 5001
source : AO5

415) chain B
residue 456
type
ligand
sequence V
description binding site for residue CLA F 1302
source : AO7

416) chain B
residue 457
type
ligand
sequence F
description binding site for residue CLA F 1302
source : AO7

417) chain B
residue 460
type
ligand
sequence W
description binding site for residue CLA F 1302
source : AO7

418) chain B
residue 472
type
ligand
sequence F
description binding site for residue CLA F 1302
source : AO7

419) chain B
residue 429
type
ligand
sequence F
description binding site for residue BCR F 4014
source : AO8

420) chain B
residue 426
type
ligand
sequence F
description binding site for residue C7Z J 4015
source : AP4

421) chain B
residue 427
type
ligand
sequence L
description binding site for residue C7Z J 4015
source : AP4

422) chain B
residue 430
type
ligand
sequence H
description binding site for residue C7Z J 4015
source : AP4

423) chain B
residue 434
type
ligand
sequence L
description binding site for residue C7Z J 4015
source : AP4

424) chain B
residue 451
type
ligand
sequence I
description binding site for residue C7Z J 4015
source : AP4

425) chain B
residue 453
type
ligand
sequence I
description binding site for residue C7Z J 4015
source : AP4

426) chain B
residue 514
type
ligand
sequence F
description binding site for residue C7Z J 4015
source : AP4

427) chain B
residue 518
type
ligand
sequence H
description binding site for residue C7Z J 4015
source : AP4

428) chain B
residue 684
type
ligand
sequence L
description binding site for residue CLA L 1502
source : AQ3

429) chain B
residue 687
type
ligand
sequence L
description binding site for residue CLA L 1502
source : AQ3

430) chain B
residue 56
type
ligand
sequence I
description binding site for residue ECH M 4021
source : AQ4

431) chain B
residue 440
type binding
ligand CLA: CHLOROPHYLL A
sequence V
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1107

432) chain B
residue 444
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1107

433) chain B
residue 429-430
type binding
ligand CLA: CHLOROPHYLL A
sequence FH
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1230

434) chain B
residue 433-434
type binding
ligand CLA: CHLOROPHYLL A
sequence GL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1230

435) chain B
residue 436-437
type binding
ligand CLA: CHLOROPHYLL A
sequence VH
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1230

436) chain B
residue 440-441
type binding
ligand CLA: CHLOROPHYLL A
sequence VV
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1230

437) chain B
residue 444
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1230

438) chain B
residue 449
type binding
ligand CLA: CHLOROPHYLL A
sequence K
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1230

439) chain B
residue 451
type binding
ligand CLA: CHLOROPHYLL A
sequence I
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1230

440) chain B
residue 677-678
type binding
ligand CLA: CHLOROPHYLL A
sequence WA
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1130

441) chain B
residue 681-683
type binding
ligand CLA: CHLOROPHYLL A
sequence RTP
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1130

442) chain B
residue 675
type binding
ligand CLA: CHLOROPHYLL A
sequence I
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1237

443) chain B
residue 678-679
type binding
ligand CLA: CHLOROPHYLL A
sequence AH
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1237

444) chain B
residue 682
type binding
ligand CLA: CHLOROPHYLL A
sequence T
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1237

445) chain B
residue 685
type binding
ligand CLA: CHLOROPHYLL A
sequence A
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1237

446) chain B
residue 688
type binding
ligand CLA: CHLOROPHYLL A
sequence V
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1237

447) chain B
residue 652
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1023

448) chain B
residue 655-656
type binding
ligand CLA: CHLOROPHYLL A
sequence AT
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1023

449) chain B
residue 658-659
type binding
ligand CLA: CHLOROPHYLL A
sequence FM
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1023

450) chain B
residue 662-663
type binding
ligand CLA: CHLOROPHYLL A
sequence IS
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1023

451) chain B
residue 667-668
type binding
ligand CLA: CHLOROPHYLL A
sequence YW
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1023

452) chain B
residue 671
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1023

453) chain B
residue 642
type binding
ligand BCR: BETA-CAROTENE
sequence V
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4017

454) chain B
residue 645-646
type binding
ligand BCR: BETA-CAROTENE
sequence WM
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4017

455) chain B
residue 649
type binding
ligand BCR: BETA-CAROTENE
sequence F
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4017

456) chain B
residue 668
type binding
ligand BCR: BETA-CAROTENE
sequence W
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4017

457) chain B
residue 671-672
type binding
ligand BCR: BETA-CAROTENE
sequence LI
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4017

458) chain B
residue 675
type binding
ligand BCR: BETA-CAROTENE
sequence I
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4017

459) chain B
residue 95
type binding
ligand CLA: CHLOROPHYLL A
sequence H
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1132

460) chain B
residue 645
type binding
ligand CLA: CHLOROPHYLL A
sequence W
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1132

461) chain B
residue 632
type binding
ligand CLA: CHLOROPHYLL A
sequence Y
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1022

462) chain B
residue 645
type binding
ligand CLA: CHLOROPHYLL A
sequence W
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1022

463) chain B
residue 648-649
type binding
ligand CLA: CHLOROPHYLL A
sequence LF
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1022

464) chain B
residue 651-652
type binding
ligand CLA: CHLOROPHYLL A
sequence HL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1022

465) chain B
residue 654-655
type binding
ligand CLA: CHLOROPHYLL A
sequence WA
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1022

466) chain B
residue 658
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1022

467) chain B
residue 89-96
type binding
ligand CLA: CHLOROPHYLL A
sequence HAIWDPHF
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1206

468) chain B
residue 100
type binding
ligand CLA: CHLOROPHYLL A
sequence A
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1206

469) chain B
residue 104
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1206

470) chain B
residue 114
type binding
ligand CLA: CHLOROPHYLL A
sequence N
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1206

471) chain B
residue 641-642
type binding
ligand CLA: CHLOROPHYLL A
sequence SV
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1206

472) chain B
residue 645
type binding
ligand CLA: CHLOROPHYLL A
sequence W
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1206

473) chain B
residue 555-556
type binding
ligand SF4: IRON/SULFUR CLUSTER
sequence PC
description IRON/SULFUR CLUSTER binding site
source pdb_hetatom : SF4_6hqb_A_3001

474) chain B
residue 558-559
type binding
ligand SF4: IRON/SULFUR CLUSTER
sequence GP
description IRON/SULFUR CLUSTER binding site
source pdb_hetatom : SF4_6hqb_A_3001

475) chain B
residue 564-566
type binding
ligand SF4: IRON/SULFUR CLUSTER
sequence TCD
description IRON/SULFUR CLUSTER binding site
source pdb_hetatom : SF4_6hqb_A_3001

476) chain B
residue 664
type binding
ligand SF4: IRON/SULFUR CLUSTER
sequence W
description IRON/SULFUR CLUSTER binding site
source pdb_hetatom : SF4_6hqb_A_3001

477) chain B
residue 699
type binding
ligand SF4: IRON/SULFUR CLUSTER
sequence I
description IRON/SULFUR CLUSTER binding site
source pdb_hetatom : SF4_6hqb_A_3001

478) chain B
residue 703
type binding
ligand SF4: IRON/SULFUR CLUSTER
sequence R
description IRON/SULFUR CLUSTER binding site
source pdb_hetatom : SF4_6hqb_A_3001

479) chain B
residue 589
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1011

480) chain B
residue 617
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1011

481) chain B
residue 621-622
type binding
ligand CLA: CHLOROPHYLL A
sequence LW
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1011

482) chain B
residue 428
type binding
ligand CLA: CHLOROPHYLL A
sequence G
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1021

483) chain B
residue 431-432
type binding
ligand CLA: CHLOROPHYLL A
sequence TL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1021

484) chain B
residue 435
type binding
ligand CLA: CHLOROPHYLL A
sequence Y
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1021

485) chain B
residue 516
type binding
ligand CLA: CHLOROPHYLL A
sequence V
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1021

486) chain B
residue 519
type binding
ligand CLA: CHLOROPHYLL A
sequence A
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1021

487) chain B
residue 522
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1021

488) chain B
residue 582
type binding
ligand CLA: CHLOROPHYLL A
sequence N
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1021

489) chain B
residue 585-586
type binding
ligand CLA: CHLOROPHYLL A
sequence GW
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1021

490) chain B
residue 589
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1021

491) chain B
residue 613
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1021

492) chain B
residue 616-617
type binding
ligand CLA: CHLOROPHYLL A
sequence WF
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1021

493) chain B
residue 621-622
type binding
ligand CLA: CHLOROPHYLL A
sequence LW
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1021

494) chain B
residue 625
type binding
ligand CLA: CHLOROPHYLL A
sequence S
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1021

495) chain B
residue 629
type binding
ligand CLA: CHLOROPHYLL A
sequence I
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1021

496) chain B
residue 647
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1021

497) chain B
residue 651
type binding
ligand CLA: CHLOROPHYLL A
sequence H
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1021

498) chain B
residue 654
type binding
ligand CLA: CHLOROPHYLL A
sequence W
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1021

499) chain B
residue 710
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1021

500) chain B
residue 713-714
type binding
ligand CLA: CHLOROPHYLL A
sequence GY
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1021

501) chain B
residue 717-718
type binding
ligand CLA: CHLOROPHYLL A
sequence TY
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1021

502) chain B
residue 721
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1021

503) chain B
residue 432
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1012

504) chain B
residue 436
type binding
ligand CLA: CHLOROPHYLL A
sequence V
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1012

505) chain B
residue 439-440
type binding
ligand CLA: CHLOROPHYLL A
sequence DV
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1012

506) chain B
residue 522
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1012

507) chain B
residue 578-579
type binding
ligand CLA: CHLOROPHYLL A
sequence FW
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1012

508) chain B
residue 582
type binding
ligand CLA: CHLOROPHYLL A
sequence N
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1012

509) chain B
residue 586
type binding
ligand CLA: CHLOROPHYLL A
sequence W
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1012

510) chain B
residue 613
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1012

511) chain B
residue 617
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1012

512) chain B
residue 621
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1012

513) chain B
residue 654
type binding
ligand CLA: CHLOROPHYLL A
sequence W
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1012

514) chain B
residue 710
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1012

515) chain B
residue 714
type binding
ligand CLA: CHLOROPHYLL A
sequence Y
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1012

516) chain B
residue 429
type binding
ligand 45D: beta,beta-carotene-4,4'-dione
sequence F
description beta,beta-carotene-4,4'-dione binding site
source pdb_hetatom : 45D_6hqb_B_4011

517) chain B
residue 432-433
type binding
ligand 45D: beta,beta-carotene-4,4'-dione
sequence LG
description beta,beta-carotene-4,4'-dione binding site
source pdb_hetatom : 45D_6hqb_B_4011

518) chain B
residue 436
type binding
ligand 45D: beta,beta-carotene-4,4'-dione
sequence V
description beta,beta-carotene-4,4'-dione binding site
source pdb_hetatom : 45D_6hqb_B_4011

519) chain B
residue 421
type binding
ligand CLA: CHLOROPHYLL A
sequence S
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1013

520) chain B
residue 424-425
type binding
ligand CLA: CHLOROPHYLL A
sequence SL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1013

521) chain B
residue 428-429
type binding
ligand CLA: CHLOROPHYLL A
sequence GF
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1013

522) chain B
residue 432
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1013

523) chain B
residue 522
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1013

524) chain B
residue 526
type binding
ligand CLA: CHLOROPHYLL A
sequence T
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1013

525) chain B
residue 529-530
type binding
ligand CLA: CHLOROPHYLL A
sequence LI
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1013

526) chain B
residue 575
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1013

527) chain B
residue 578-579
type binding
ligand CLA: CHLOROPHYLL A
sequence FW
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1013

528) chain B
residue 425
type binding
ligand BCR: BETA-CAROTENE
sequence L
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_F_4014

529) chain B
residue 429
type binding
ligand BCR: BETA-CAROTENE
sequence F
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_F_4014

530) chain B
residue 418-419
type binding
ligand CLA: CHLOROPHYLL A
sequence SH
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1138

531) chain B
residue 421-422
type binding
ligand CLA: CHLOROPHYLL A
sequence SW
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1138

532) chain B
residue 425
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1138

533) chain B
residue 429
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_A_1138

534) chain B
residue 415
type binding
ligand CLA: CHLOROPHYLL A
sequence A
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1228

535) chain B
residue 419
type binding
ligand CLA: CHLOROPHYLL A
sequence H
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1228

536) chain B
residue 422
type binding
ligand CLA: CHLOROPHYLL A
sequence W
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1228

537) chain B
residue 396
type binding
ligand SQD: 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
sequence Y
description 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL binding site
source pdb_hetatom : SQD_6hqb_F_5001

538) chain B
residue 398
type binding
ligand SQD: 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
sequence P
description 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL binding site
source pdb_hetatom : SQD_6hqb_F_5001

539) chain B
residue 402-403
type binding
ligand SQD: 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
sequence KD
description 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL binding site
source pdb_hetatom : SQD_6hqb_F_5001

540) chain B
residue 407-408
type binding
ligand SQD: 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
sequence AR
description 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL binding site
source pdb_hetatom : SQD_6hqb_F_5001

541) chain B
residue 410-411
type binding
ligand SQD: 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
sequence LE
description 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL binding site
source pdb_hetatom : SQD_6hqb_F_5001

542) chain B
residue 457
type binding
ligand C7Z: (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol
sequence F
description (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol binding site
source pdb_hetatom : C7Z_6hqb_F_4016

543) chain B
residue 5
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1201

544) chain B
residue 7-8
type binding
ligand CLA: CHLOROPHYLL A
sequence KF
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1201

545) chain B
residue 24-25
type binding
ligand CLA: CHLOROPHYLL A
sequence GI
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1201

546) chain B
residue 27-29
type binding
ligand CLA: CHLOROPHYLL A
sequence TAH
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1201

547) chain B
residue 31
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1201

548) chain B
residue 34
type binding
ligand CLA: CHLOROPHYLL A
sequence H
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1201

549) chain B
residue 45
type binding
ligand CLA: CHLOROPHYLL A
sequence K
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1201

550) chain B
residue 49
type binding
ligand CLA: CHLOROPHYLL A
sequence S
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1201

551) chain B
residue 53
type binding
ligand CLA: CHLOROPHYLL A
sequence H
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1201

552) chain B
residue 56
type binding
ligand CLA: CHLOROPHYLL A
sequence I
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1201

553) chain B
residue 12
type binding
ligand LMG: 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
sequence L
description 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE binding site
source pdb_hetatom : LMG_6hqb_B_5002

554) chain B
residue 22-23
type binding
ligand LMG: 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
sequence WY
description 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE binding site
source pdb_hetatom : LMG_6hqb_B_5002

555) chain B
residue 26-27
type binding
ligand LMG: 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
sequence AT
description 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE binding site
source pdb_hetatom : LMG_6hqb_B_5002

556) chain B
residue 379
type binding
ligand LMG: 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
sequence F
description 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE binding site
source pdb_hetatom : LMG_6hqb_B_5002

557) chain B
residue 394
type binding
ligand LMG: 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
sequence R
description 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE binding site
source pdb_hetatom : LMG_6hqb_B_5002

558) chain B
residue 552-553
type binding
ligand LMG: 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
sequence YS
description 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE binding site
source pdb_hetatom : LMG_6hqb_B_5002

559) chain B
residue 570
type binding
ligand LMG: 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
sequence W
description 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE binding site
source pdb_hetatom : LMG_6hqb_B_5002

560) chain B
residue 573
type binding
ligand LMG: 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
sequence F
description 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE binding site
source pdb_hetatom : LMG_6hqb_B_5002

561) chain B
residue 577
type binding
ligand LMG: 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
sequence M
description 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE binding site
source pdb_hetatom : LMG_6hqb_B_5002

562) chain B
residue 698
type binding
ligand LMG: 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
sequence S
description 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE binding site
source pdb_hetatom : LMG_6hqb_B_5002

563) chain B
residue 700-701
type binding
ligand LMG: 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
sequence VQ
description 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE binding site
source pdb_hetatom : LMG_6hqb_B_5002

564) chain B
residue 704-705
type binding
ligand LMG: 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
sequence LV
description 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE binding site
source pdb_hetatom : LMG_6hqb_B_5002

565) chain B
residue 707-708
type binding
ligand LMG: 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
sequence LA
description 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE binding site
source pdb_hetatom : LMG_6hqb_B_5002

566) chain B
residue 711-712
type binding
ligand LMG: 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
sequence TV
description 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE binding site
source pdb_hetatom : LMG_6hqb_B_5002

567) chain B
residue 715-716
type binding
ligand LMG: 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
sequence VL
description 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE binding site
source pdb_hetatom : LMG_6hqb_B_5002

568) chain B
residue 18
type binding
ligand CLA: CHLOROPHYLL A
sequence T
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1238

569) chain B
residue 21-22
type binding
ligand CLA: CHLOROPHYLL A
sequence IW
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1238

570) chain B
residue 672
type binding
ligand CLA: CHLOROPHYLL A
sequence I
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1238

571) chain B
residue 675-676
type binding
ligand CLA: CHLOROPHYLL A
sequence IV
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1238

572) chain B
residue 679
type binding
ligand CLA: CHLOROPHYLL A
sequence H
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1238

573) chain B
residue 688-692
type binding
ligand CLA: CHLOROPHYLL A
sequence VRWKD
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1238

574) chain B
residue 694-695
type binding
ligand CLA: CHLOROPHYLL A
sequence PV
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1238

575) chain B
residue 22
type binding
ligand CLA: CHLOROPHYLL A
sequence W
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1239

576) chain B
residue 649
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1239

577) chain B
residue 652-653
type binding
ligand CLA: CHLOROPHYLL A
sequence LV
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1239

578) chain B
residue 656
type binding
ligand CLA: CHLOROPHYLL A
sequence T
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1239

579) chain B
residue 659-660
type binding
ligand CLA: CHLOROPHYLL A
sequence MF
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1239

580) chain B
residue 697
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1239

581) chain B
residue 701
type binding
ligand CLA: CHLOROPHYLL A
sequence Q
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1239

582) chain B
residue 705
type binding
ligand CLA: CHLOROPHYLL A
sequence V
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1239

583) chain B
residue 708-709
type binding
ligand CLA: CHLOROPHYLL A
sequence AH
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1239

584) chain B
residue 712
type binding
ligand CLA: CHLOROPHYLL A
sequence V
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1239

585) chain B
residue 22
type binding
ligand PQN: PHYLLOQUINONE
sequence W
description PHYLLOQUINONE binding site
source pdb_hetatom : PQN_6hqb_B_2002

586) chain B
residue 25
type binding
ligand PQN: PHYLLOQUINONE
sequence I
description PHYLLOQUINONE binding site
source pdb_hetatom : PQN_6hqb_B_2002

587) chain B
residue 659-660
type binding
ligand PQN: PHYLLOQUINONE
sequence MF
description PHYLLOQUINONE binding site
source pdb_hetatom : PQN_6hqb_B_2002

588) chain B
residue 663-665
type binding
ligand PQN: PHYLLOQUINONE
sequence SWR
description PHYLLOQUINONE binding site
source pdb_hetatom : PQN_6hqb_B_2002

589) chain B
residue 668
type binding
ligand PQN: PHYLLOQUINONE
sequence W
description PHYLLOQUINONE binding site
source pdb_hetatom : PQN_6hqb_B_2002

590) chain B
residue 672
type binding
ligand PQN: PHYLLOQUINONE
sequence I
description PHYLLOQUINONE binding site
source pdb_hetatom : PQN_6hqb_B_2002

591) chain B
residue 695-698
type binding
ligand PQN: PHYLLOQUINONE
sequence VALS
description PHYLLOQUINONE binding site
source pdb_hetatom : PQN_6hqb_B_2002

592) chain B
residue 702
type binding
ligand PQN: PHYLLOQUINONE
sequence A
description PHYLLOQUINONE binding site
source pdb_hetatom : PQN_6hqb_B_2002

593) chain B
residue 25-30
type binding
ligand CLA: CHLOROPHYLL A
sequence IATAHD
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1226

594) chain B
residue 329
type binding
ligand CLA: CHLOROPHYLL A
sequence H
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1226

595) chain B
residue 332
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1226

596) chain B
residue 336
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1226

597) chain B
residue 379-380
type binding
ligand CLA: CHLOROPHYLL A
sequence FL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1226

598) chain B
residue 382-383
type binding
ligand CLA: CHLOROPHYLL A
sequence VG
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1226

599) chain B
residue 386-387
type binding
ligand CLA: CHLOROPHYLL A
sequence AH
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1226

600) chain B
residue 390
type binding
ligand CLA: CHLOROPHYLL A
sequence I
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1226

601) chain B
residue 394
type binding
ligand CLA: CHLOROPHYLL A
sequence R
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1226

602) chain B
residue 552-553
type binding
ligand CLA: CHLOROPHYLL A
sequence YS
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1226

603) chain B
residue 570
type binding
ligand CLA: CHLOROPHYLL A
sequence W
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1226

604) chain B
residue 573
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1226

605) chain B
residue 577
type binding
ligand CLA: CHLOROPHYLL A
sequence M
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1226

606) chain B
residue 29
type binding
ligand CLA: CHLOROPHYLL A
sequence H
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1202

607) chain B
residue 31-32
type binding
ligand CLA: CHLOROPHYLL A
sequence FE
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1202

608) chain B
residue 42-43
type binding
ligand CLA: CHLOROPHYLL A
sequence LY
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1202

609) chain B
residue 46-47
type binding
ligand CLA: CHLOROPHYLL A
sequence IF
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1202

610) chain B
residue 49-50
type binding
ligand CLA: CHLOROPHYLL A
sequence SH
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1202

611) chain B
residue 53-54
type binding
ligand CLA: CHLOROPHYLL A
sequence HI
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1202

612) chain B
residue 57
type binding
ligand CLA: CHLOROPHYLL A
sequence I
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1202

613) chain B
residue 168
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1202

614) chain B
residue 174
type binding
ligand CLA: CHLOROPHYLL A
sequence R
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1202

615) chain B
residue 178
type binding
ligand CLA: CHLOROPHYLL A
sequence H
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1202

616) chain B
residue 182-183
type binding
ligand CLA: CHLOROPHYLL A
sequence LF
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1202

617) chain B
residue 328-329
type binding
ligand CLA: CHLOROPHYLL A
sequence LH
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1202

618) chain B
residue 331-332
type binding
ligand CLA: CHLOROPHYLL A
sequence QL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1202

619) chain B
residue 335-336
type binding
ligand CLA: CHLOROPHYLL A
sequence AL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1202

620) chain B
residue 339
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1202

621) chain B
residue 29
type binding
ligand CLA: CHLOROPHYLL A
sequence H
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1203

622) chain B
residue 53
type binding
ligand CLA: CHLOROPHYLL A
sequence H
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1203

623) chain B
residue 56-57
type binding
ligand CLA: CHLOROPHYLL A
sequence II
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1203

624) chain B
residue 60
type binding
ligand CLA: CHLOROPHYLL A
sequence W
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1203

625) chain B
residue 336
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1203

626) chain B
residue 339
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1203

627) chain B
residue 380
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1203

628) chain B
residue 47
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1210

629) chain B
residue 50-51
type binding
ligand CLA: CHLOROPHYLL A
sequence HF
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1210

630) chain B
residue 54
type binding
ligand CLA: CHLOROPHYLL A
sequence I
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1210

631) chain B
residue 149
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1210

632) chain B
residue 167-168
type binding
ligand CLA: CHLOROPHYLL A
sequence WF
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1210

633) chain B
residue 170
type binding
ligand CLA: CHLOROPHYLL A
sequence N
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1210

634) chain B
residue 173-174
type binding
ligand CLA: CHLOROPHYLL A
sequence SR
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1210

635) chain B
residue 177-178
type binding
ligand CLA: CHLOROPHYLL A
sequence HH
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1210

636) chain B
residue 181-183
type binding
ligand CLA: CHLOROPHYLL A
sequence GLF
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1210

637) chain B
residue 47
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1208

638) chain B
residue 51
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1208

639) chain B
residue 54
type binding
ligand CLA: CHLOROPHYLL A
sequence I
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1208

640) chain B
residue 148-149
type binding
ligand CLA: CHLOROPHYLL A
sequence LF
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1208

641) chain B
residue 151-152
type binding
ligand CLA: CHLOROPHYLL A
sequence FA
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1208

642) chain B
residue 155-156
type binding
ligand CLA: CHLOROPHYLL A
sequence LH
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1208

643) chain B
residue 160-161
type binding
ligand CLA: CHLOROPHYLL A
sequence KF
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1208

644) chain B
residue 163
type binding
ligand CLA: CHLOROPHYLL A
sequence P
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1208

645) chain B
residue 167
type binding
ligand CLA: CHLOROPHYLL A
sequence W
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1208

646) chain B
residue 52
type binding
ligand ECH: beta,beta-caroten-4-one
sequence G
description beta,beta-caroten-4-one binding site
source pdb_hetatom : ECH_6hqb_M_4021

647) chain B
residue 56
type binding
ligand ECH: beta,beta-caroten-4-one
sequence I
description beta,beta-caroten-4-one binding site
source pdb_hetatom : ECH_6hqb_M_4021

648) chain B
residue 59
type binding
ligand ECH: beta,beta-caroten-4-one
sequence L
description beta,beta-caroten-4-one binding site
source pdb_hetatom : ECH_6hqb_M_4021

649) chain B
residue 150
type binding
ligand ECH: beta,beta-caroten-4-one
sequence L
description beta,beta-caroten-4-one binding site
source pdb_hetatom : ECH_6hqb_M_4021

650) chain B
residue 54
type binding
ligand BCR: BETA-CAROTENE
sequence I
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4005

651) chain B
residue 57-58
type binding
ligand BCR: BETA-CAROTENE
sequence IF
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4005

652) chain B
residue 60
type binding
ligand BCR: BETA-CAROTENE
sequence W
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4005

653) chain B
residue 149
type binding
ligand BCR: BETA-CAROTENE
sequence F
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4005

654) chain B
residue 181-182
type binding
ligand BCR: BETA-CAROTENE
sequence GL
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4005

655) chain B
residue 185-186
type binding
ligand BCR: BETA-CAROTENE
sequence VS
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4005

656) chain B
residue 57-58
type binding
ligand CLA: CHLOROPHYLL A
sequence IF
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1225

657) chain B
residue 60-61
type binding
ligand CLA: CHLOROPHYLL A
sequence WT
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1225

658) chain B
residue 118-120
type binding
ligand CLA: CHLOROPHYLL A
sequence SGV
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1225

659) chain B
residue 123
type binding
ligand CLA: CHLOROPHYLL A
sequence W
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1225

660) chain B
residue 339
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1225

661) chain B
residue 342-343
type binding
ligand CLA: CHLOROPHYLL A
sequence IT
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1225

662) chain B
residue 346
type binding
ligand CLA: CHLOROPHYLL A
sequence V
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1225

663) chain B
residue 350
type binding
ligand CLA: CHLOROPHYLL A
sequence M
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1225

664) chain B
residue 356
type binding
ligand CLA: CHLOROPHYLL A
sequence Y
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1225

665) chain B
residue 359
type binding
ligand CLA: CHLOROPHYLL A
sequence I
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1225

666) chain B
residue 369
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1225

667) chain B
residue 372-373
type binding
ligand CLA: CHLOROPHYLL A
sequence HH
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1225

668) chain B
residue 376
type binding
ligand CLA: CHLOROPHYLL A
sequence I
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1225

669) chain B
residue 380
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1225

670) chain B
residue 59-60
type binding
ligand CLA: CHLOROPHYLL A
sequence LW
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1204

671) chain B
residue 62-63
type binding
ligand CLA: CHLOROPHYLL A
sequence SG
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1204

672) chain B
residue 66-67
type binding
ligand CLA: CHLOROPHYLL A
sequence FH
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1204

673) chain B
residue 70-71
type binding
ligand CLA: CHLOROPHYLL A
sequence WQ
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1204

674) chain B
residue 90-92
type binding
ligand CLA: CHLOROPHYLL A
sequence AIW
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1204

675) chain B
residue 143
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1204

676) chain B
residue 60
type binding
ligand CLA: CHLOROPHYLL A
sequence W
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1224

677) chain B
residue 64
type binding
ligand CLA: CHLOROPHYLL A
sequence T
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1224

678) chain B
residue 117-118
type binding
ligand CLA: CHLOROPHYLL A
sequence YS
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1224

679) chain B
residue 367-369
type binding
ligand CLA: CHLOROPHYLL A
sequence AAL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1224

680) chain B
residue 371-372
type binding
ligand CLA: CHLOROPHYLL A
sequence TH
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1224

681) chain B
residue 375-376
type binding
ligand CLA: CHLOROPHYLL A
sequence YI
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1224

682) chain B
residue 379
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1224

683) chain B
residue 643
type binding
ligand CLA: CHLOROPHYLL A
sequence W
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1224

684) chain B
residue 646
type binding
ligand CLA: CHLOROPHYLL A
sequence M
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1224

685) chain B
residue 715-716
type binding
ligand CLA: CHLOROPHYLL A
sequence VL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1224

686) chain B
residue 718-719
type binding
ligand CLA: CHLOROPHYLL A
sequence YA
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1224

687) chain B
residue 722-723
type binding
ligand CLA: CHLOROPHYLL A
sequence LI
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1224

688) chain B
residue 60
type binding
ligand CLA: CHLOROPHYLL A
sequence W
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1205

689) chain B
residue 64
type binding
ligand CLA: CHLOROPHYLL A
sequence T
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1205

690) chain B
residue 67-68
type binding
ligand CLA: CHLOROPHYLL A
sequence HV
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1205

691) chain B
residue 88-89
type binding
ligand CLA: CHLOROPHYLL A
sequence AH
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1205

692) chain B
residue 114-118
type binding
ligand CLA: CHLOROPHYLL A
sequence NIAYS
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1205

693) chain B
residue 120
type binding
ligand CLA: CHLOROPHYLL A
sequence V
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1205

694) chain B
residue 642-643
type binding
ligand CLA: CHLOROPHYLL A
sequence VW
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1205

695) chain B
residue 646
type binding
ligand CLA: CHLOROPHYLL A
sequence M
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1205

696) chain B
residue 61
type binding
ligand ECH: beta,beta-caroten-4-one
sequence T
description beta,beta-caroten-4-one binding site
source pdb_hetatom : ECH_6hqb_B_4006

697) chain B
residue 65
type binding
ligand ECH: beta,beta-caroten-4-one
sequence L
description beta,beta-caroten-4-one binding site
source pdb_hetatom : ECH_6hqb_B_4006

698) chain B
residue 123-124
type binding
ligand ECH: beta,beta-caroten-4-one
sequence WF
description beta,beta-caroten-4-one binding site
source pdb_hetatom : ECH_6hqb_B_4006

699) chain B
residue 127
type binding
ligand ECH: beta,beta-caroten-4-one
sequence I
description beta,beta-caroten-4-one binding site
source pdb_hetatom : ECH_6hqb_B_4006

700) chain B
residue 129
type binding
ligand ECH: beta,beta-caroten-4-one
sequence M
description beta,beta-caroten-4-one binding site
source pdb_hetatom : ECH_6hqb_B_4006

701) chain B
residue 135
type binding
ligand ECH: beta,beta-caroten-4-one
sequence L
description beta,beta-caroten-4-one binding site
source pdb_hetatom : ECH_6hqb_B_4006

702) chain B
residue 138-139
type binding
ligand ECH: beta,beta-caroten-4-one
sequence GA
description beta,beta-caroten-4-one binding site
source pdb_hetatom : ECH_6hqb_B_4006

703) chain B
residue 141-142
type binding
ligand ECH: beta,beta-caroten-4-one
sequence FL
description beta,beta-caroten-4-one binding site
source pdb_hetatom : ECH_6hqb_B_4006

704) chain B
residue 145
type binding
ligand ECH: beta,beta-caroten-4-one
sequence L
description beta,beta-caroten-4-one binding site
source pdb_hetatom : ECH_6hqb_B_4006

705) chain B
residue 190
type binding
ligand ECH: beta,beta-caroten-4-one
sequence W
description beta,beta-caroten-4-one binding site
source pdb_hetatom : ECH_6hqb_B_4006

706) chain B
residue 209
type binding
ligand ECH: beta,beta-caroten-4-one
sequence W
description beta,beta-caroten-4-one binding site
source pdb_hetatom : ECH_6hqb_B_4006

707) chain B
residue 212-213
type binding
ligand ECH: beta,beta-caroten-4-one
sequence FL
description beta,beta-caroten-4-one binding site
source pdb_hetatom : ECH_6hqb_B_4006

708) chain B
residue 94-95
type binding
ligand CLA: CHLOROPHYLL A
sequence PH
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1207

709) chain B
residue 123
type binding
ligand CLA: CHLOROPHYLL A
sequence W
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1215

710) chain B
residue 126-127
type binding
ligand CLA: CHLOROPHYLL A
sequence TI
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1215

711) chain B
residue 182-183
type binding
ligand CLA: CHLOROPHYLL A
sequence LF
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1215

712) chain B
residue 186-187
type binding
ligand CLA: CHLOROPHYLL A
sequence SS
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1215

713) chain B
residue 190
type binding
ligand CLA: CHLOROPHYLL A
sequence W
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1215

714) chain B
residue 194
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1215

715) chain B
residue 268
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1215

716) chain B
residue 273
type binding
ligand CLA: CHLOROPHYLL A
sequence I
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1215

717) chain B
residue 276-277
type binding
ligand CLA: CHLOROPHYLL A
sequence HH
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1215

718) chain B
residue 280
type binding
ligand CLA: CHLOROPHYLL A
sequence I
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1215

719) chain B
residue 284
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1215

720) chain B
residue 345-346
type binding
ligand CLA: CHLOROPHYLL A
sequence LV
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1215

721) chain B
residue 349-350
type binding
ligand CLA: CHLOROPHYLL A
sequence HM
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1215

722) chain B
residue 355-356
type binding
ligand CLA: CHLOROPHYLL A
sequence SY
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1215

723) chain B
residue 127-129
type binding
ligand CLA: CHLOROPHYLL A
sequence IGM
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1211

724) chain B
residue 134
type binding
ligand CLA: CHLOROPHYLL A
sequence E
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1211

725) chain B
residue 137-138
type binding
ligand CLA: CHLOROPHYLL A
sequence SG
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1211

726) chain B
residue 141
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1211

727) chain B
residue 186
type binding
ligand CLA: CHLOROPHYLL A
sequence S
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1211

728) chain B
residue 189-190
type binding
ligand CLA: CHLOROPHYLL A
sequence AW
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1211

729) chain B
residue 192-193
type binding
ligand CLA: CHLOROPHYLL A
sequence GH
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1211

730) chain B
residue 196-197
type binding
ligand CLA: CHLOROPHYLL A
sequence HV
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1211

731) chain B
residue 207-209
type binding
ligand CLA: CHLOROPHYLL A
sequence VGW
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1211

732) chain B
residue 212
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1211

733) chain B
residue 148
type binding
ligand SQD: 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
sequence L
description 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL binding site
source pdb_hetatom : SQD_6hqb_B_5008

734) chain B
residue 151
type binding
ligand SQD: 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
sequence F
description 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL binding site
source pdb_hetatom : SQD_6hqb_B_5008

735) chain B
residue 154-155
type binding
ligand SQD: 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
sequence WL
description 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL binding site
source pdb_hetatom : SQD_6hqb_B_5008

736) chain B
residue 158-161
type binding
ligand SQD: 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
sequence QPKF
description 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL binding site
source pdb_hetatom : SQD_6hqb_B_5008

737) chain B
residue 167
type binding
ligand CLA: CHLOROPHYLL A
sequence W
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1209

738) chain B
residue 170
type binding
ligand CLA: CHLOROPHYLL A
sequence N
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1209

739) chain B
residue 173
type binding
ligand CLA: CHLOROPHYLL A
sequence S
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1209

740) chain B
residue 177
type binding
ligand CLA: CHLOROPHYLL A
sequence H
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1209

741) chain B
residue 293-295
type binding
ligand CLA: CHLOROPHYLL A
sequence TNW
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1209

742) chain B
residue 170-171
type binding
ligand CLA: CHLOROPHYLL A
sequence NA
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1221

743) chain B
residue 174-175
type binding
ligand CLA: CHLOROPHYLL A
sequence RL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1221

744) chain B
residue 178-179
type binding
ligand CLA: CHLOROPHYLL A
sequence HL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1221

745) chain B
residue 183
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1221

746) chain B
residue 301
type binding
ligand CLA: CHLOROPHYLL A
sequence I
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1221

747) chain B
residue 305
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1221

748) chain B
residue 321
type binding
ligand CLA: CHLOROPHYLL A
sequence Y
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1221

749) chain B
residue 324-325
type binding
ligand CLA: CHLOROPHYLL A
sequence IN
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1221

750) chain B
residue 334-335
type binding
ligand CLA: CHLOROPHYLL A
sequence LA
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1221

751) chain B
residue 338-339
type binding
ligand CLA: CHLOROPHYLL A
sequence SL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1221

752) chain B
residue 342
type binding
ligand CLA: CHLOROPHYLL A
sequence I
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1221

753) chain B
residue 175
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1216

754) chain B
residue 179
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1216

755) chain B
residue 183
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1216

756) chain B
residue 283-284
type binding
ligand CLA: CHLOROPHYLL A
sequence IF
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1216

757) chain B
residue 286-287
type binding
ligand CLA: CHLOROPHYLL A
sequence IA
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1216

758) chain B
residue 290-291
type binding
ligand CLA: CHLOROPHYLL A
sequence MY
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1216

759) chain B
residue 301
type binding
ligand CLA: CHLOROPHYLL A
sequence I
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1216

760) chain B
residue 304-305
type binding
ligand CLA: CHLOROPHYLL A
sequence IL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1216

761) chain B
residue 176-177
type binding
ligand CLA: CHLOROPHYLL A
sequence NH
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1217

762) chain B
residue 180-181
type binding
ligand CLA: CHLOROPHYLL A
sequence AG
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1217

763) chain B
residue 185
type binding
ligand CLA: CHLOROPHYLL A
sequence V
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1217

764) chain B
residue 285
type binding
ligand CLA: CHLOROPHYLL A
sequence I
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1217

765) chain B
residue 288-291
type binding
ligand CLA: CHLOROPHYLL A
sequence GHMY
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1217

766) chain B
residue 293
type binding
ligand CLA: CHLOROPHYLL A
sequence T
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1217

767) chain B
residue 295
type binding
ligand CLA: CHLOROPHYLL A
sequence W
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1217

768) chain B
residue 297
type binding
ligand CLA: CHLOROPHYLL A
sequence I
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1217

769) chain B
residue 188-189
type binding
ligand CLA: CHLOROPHYLL A
sequence LA
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1212

770) chain B
residue 191-192
type binding
ligand CLA: CHLOROPHYLL A
sequence AG
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1212

771) chain B
residue 195-196
type binding
ligand CLA: CHLOROPHYLL A
sequence VH
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1212

772) chain B
residue 212-217
type binding
ligand CLA: CHLOROPHYLL A
sequence FLSTPP
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1212

773) chain B
residue 220-222
type binding
ligand CLA: CHLOROPHYLL A
sequence AGL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1212

774) chain B
residue 226
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1212

775) chain B
residue 233
type binding
ligand CLA: CHLOROPHYLL A
sequence Y
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1212

776) chain B
residue 254-255
type binding
ligand CLA: CHLOROPHYLL A
sequence IL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1212

777) chain B
residue 278
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1212

778) chain B
residue 188
type binding
ligand BCR: BETA-CAROTENE
sequence L
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4004

779) chain B
residue 222
type binding
ligand BCR: BETA-CAROTENE
sequence L
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4004

780) chain B
residue 225
type binding
ligand BCR: BETA-CAROTENE
sequence F
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4004

781) chain B
residue 278
type binding
ligand BCR: BETA-CAROTENE
sequence L
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4004

782) chain B
residue 282
type binding
ligand BCR: BETA-CAROTENE
sequence V
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4004

783) chain B
residue 285-286
type binding
ligand BCR: BETA-CAROTENE
sequence II
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4004

784) chain B
residue 289
type binding
ligand BCR: BETA-CAROTENE
sequence H
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4004

785) chain B
residue 297
type binding
ligand BCR: BETA-CAROTENE
sequence I
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4004

786) chain B
residue 225
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1213

787) chain B
residue 230-231
type binding
ligand CLA: CHLOROPHYLL A
sequence WG
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1213

788) chain B
residue 233-234
type binding
ligand CLA: CHLOROPHYLL A
sequence YA
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1213

789) chain B
residue 255-257
type binding
ligand CLA: CHLOROPHYLL A
sequence LTF
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1213

790) chain B
residue 275
type binding
ligand CLA: CHLOROPHYLL A
sequence H
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1213

791) chain B
residue 278-279
type binding
ligand CLA: CHLOROPHYLL A
sequence LA
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1213

792) chain B
residue 282-283
type binding
ligand CLA: CHLOROPHYLL A
sequence VI
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1213

793) chain B
residue 489-490
type binding
ligand CLA: CHLOROPHYLL A
sequence AW
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1213

794) chain B
residue 256-257
type binding
ligand CLA: CHLOROPHYLL A
sequence TF
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1214

795) chain B
residue 259
type binding
ligand CLA: CHLOROPHYLL A
sequence G
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1214

796) chain B
residue 268-269
type binding
ligand CLA: CHLOROPHYLL A
sequence LW
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1214

797) chain B
residue 272-273
type binding
ligand CLA: CHLOROPHYLL A
sequence DI
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1214

798) chain B
residue 275-276
type binding
ligand CLA: CHLOROPHYLL A
sequence HH
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1214

799) chain B
residue 279-280
type binding
ligand CLA: CHLOROPHYLL A
sequence AI
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1214

800) chain B
residue 283
type binding
ligand CLA: CHLOROPHYLL A
sequence I
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1214

801) chain B
residue 349-350
type binding
ligand CLA: CHLOROPHYLL A
sequence HM
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1214

802) chain B
residue 353
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1214

803) chain B
residue 355
type binding
ligand CLA: CHLOROPHYLL A
sequence S
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1214

804) chain B
residue 490
type binding
ligand CLA: CHLOROPHYLL A
sequence W
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1214

805) chain B
residue 494
type binding
ligand CLA: CHLOROPHYLL A
sequence W
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1214

806) chain B
residue 286-287
type binding
ligand CLA: CHLOROPHYLL A
sequence IA
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1218

807) chain B
residue 289-290
type binding
ligand CLA: CHLOROPHYLL A
sequence HM
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1218

808) chain B
residue 292
type binding
ligand CLA: CHLOROPHYLL A
sequence R
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1218

809) chain B
residue 297-299
type binding
ligand CLA: CHLOROPHYLL A
sequence IGH
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1218

810) chain B
residue 286
type binding
ligand LMG: 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
sequence I
description 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE binding site
source pdb_hetatom : LMG_6hqb_B_5005

811) chain B
residue 482
type binding
ligand LMG: 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
sequence I
description 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE binding site
source pdb_hetatom : LMG_6hqb_B_5005

812) chain B
residue 486
type binding
ligand LMG: 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
sequence T
description 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE binding site
source pdb_hetatom : LMG_6hqb_B_5005

813) chain B
residue 290
type binding
ligand CLA: CHLOROPHYLL A
sequence M
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1219

814) chain B
residue 299
type binding
ligand CLA: CHLOROPHYLL A
sequence H
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1219

815) chain B
residue 303-304
type binding
ligand CLA: CHLOROPHYLL A
sequence EI
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1219

816) chain B
residue 307-308
type binding
ligand CLA: CHLOROPHYLL A
sequence AH
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1219

817) chain B
residue 304-305
type binding
ligand CLA: CHLOROPHYLL A
sequence IL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1220

818) chain B
residue 308
type binding
ligand CLA: CHLOROPHYLL A
sequence H
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1220

819) chain B
residue 317
type binding
ligand CLA: CHLOROPHYLL A
sequence H
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1220

820) chain B
residue 320
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1220

821) chain B
residue 324
type binding
ligand CLA: CHLOROPHYLL A
sequence I
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1220

822) chain B
residue 330
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1220

823) chain B
residue 405-406
type binding
ligand CLA: CHLOROPHYLL A
sequence VL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1220

824) chain B
residue 409
type binding
ligand CLA: CHLOROPHYLL A
sequence M
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1220

825) chain B
residue 307-311
type binding
ligand CLA: CHLOROPHYLL A
sequence AHKGP
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1240

826) chain B
residue 308-313
type binding
ligand LHG: 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
sequence HKGPLT
description 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE binding site
source pdb_hetatom : LHG_6hqb_B_5004

827) chain B
residue 316-317
type binding
ligand LHG: 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
sequence GH
description 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE binding site
source pdb_hetatom : LHG_6hqb_B_5004

828) chain B
residue 405
type binding
ligand LHG: 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
sequence V
description 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE binding site
source pdb_hetatom : LHG_6hqb_B_5004

829) chain B
residue 312-313
type binding
ligand CLA: CHLOROPHYLL A
sequence LT
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1227

830) chain B
residue 405
type binding
ligand CLA: CHLOROPHYLL A
sequence V
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1227

831) chain B
residue 408-409
type binding
ligand CLA: CHLOROPHYLL A
sequence RM
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1227

832) chain B
residue 412
type binding
ligand CLA: CHLOROPHYLL A
sequence H
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1227

833) chain B
residue 415-416
type binding
ligand CLA: CHLOROPHYLL A
sequence AL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1227

834) chain B
residue 419
type binding
ligand CLA: CHLOROPHYLL A
sequence H
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1227

835) chain B
residue 329-330
type binding
ligand BCR: BETA-CAROTENE
sequence HF
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4010

836) chain B
residue 333-334
type binding
ligand BCR: BETA-CAROTENE
sequence GL
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4010

837) chain B
residue 337
type binding
ligand BCR: BETA-CAROTENE
sequence A
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4010

838) chain B
residue 341
type binding
ligand BCR: BETA-CAROTENE
sequence V
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4010

839) chain B
residue 381
type binding
ligand BCR: BETA-CAROTENE
sequence M
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4010

840) chain B
residue 384-385
type binding
ligand BCR: BETA-CAROTENE
sequence AF
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4010

841) chain B
residue 388-389
type binding
ligand BCR: BETA-CAROTENE
sequence GA
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4010

842) chain B
residue 391-392
type binding
ligand BCR: BETA-CAROTENE
sequence FF
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4010

843) chain B
residue 535
type binding
ligand BCR: BETA-CAROTENE
sequence A
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4010

844) chain B
residue 334
type binding
ligand BCR: BETA-CAROTENE
sequence L
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4018

845) chain B
residue 406
type binding
ligand BCR: BETA-CAROTENE
sequence L
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4018

846) chain B
residue 409
type binding
ligand BCR: BETA-CAROTENE
sequence M
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4018

847) chain B
residue 532
type binding
ligand BCR: BETA-CAROTENE
sequence I
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4018

848) chain B
residue 536
type binding
ligand BCR: BETA-CAROTENE
sequence L
description BETA-CAROTENE binding site
source pdb_hetatom : BCR_6hqb_B_4018

849) chain B
residue 338
type binding
ligand CLA: CHLOROPHYLL A
sequence S
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1223

850) chain B
residue 341
type binding
ligand CLA: CHLOROPHYLL A
sequence V
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1223

851) chain B
residue 345
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1223

852) chain B
residue 348-349
type binding
ligand CLA: CHLOROPHYLL A
sequence QH
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1223

853) chain B
residue 351-353
type binding
ligand CLA: CHLOROPHYLL A
sequence YSL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1223

854) chain B
residue 494
type binding
ligand CLA: CHLOROPHYLL A
sequence W
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1223

855) chain B
residue 505-506
type binding
ligand CLA: CHLOROPHYLL A
sequence LF
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1223

856) chain B
residue 341
type binding
ligand CLA: CHLOROPHYLL A
sequence V
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1222

857) chain B
residue 344-345
type binding
ligand CLA: CHLOROPHYLL A
sequence SL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1222

858) chain B
residue 348
type binding
ligand CLA: CHLOROPHYLL A
sequence Q
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1222

859) chain B
residue 374
type binding
ligand CLA: CHLOROPHYLL A
sequence Q
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1222

860) chain B
residue 377-378
type binding
ligand CLA: CHLOROPHYLL A
sequence AG
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1222

861) chain B
residue 381-382
type binding
ligand CLA: CHLOROPHYLL A
sequence MV
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1222

862) chain B
residue 385
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1222

863) chain B
residue 524
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1222

864) chain B
residue 527-528
type binding
ligand CLA: CHLOROPHYLL A
sequence TA
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1222

865) chain B
residue 531-532
type binding
ligand CLA: CHLOROPHYLL A
sequence LI
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1222

866) chain B
residue 580
type binding
ligand CLA: CHLOROPHYLL A
sequence M
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1222

867) chain B
residue 584
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1222

868) chain B
residue 587
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1222

869) chain B
residue 348
type binding
ligand CLA: CHLOROPHYLL A
sequence Q
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1234

870) chain B
residue 351
type binding
ligand CLA: CHLOROPHYLL A
sequence Y
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1234

871) chain B
residue 370
type binding
ligand CLA: CHLOROPHYLL A
sequence Y
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1234

872) chain B
residue 457-458
type binding
ligand CLA: CHLOROPHYLL A
sequence FA
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1234

873) chain B
residue 460-462
type binding
ligand CLA: CHLOROPHYLL A
sequence WIQ
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1234

874) chain B
residue 506-507
type binding
ligand CLA: CHLOROPHYLL A
sequence FL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1234

875) chain B
residue 509
type binding
ligand CLA: CHLOROPHYLL A
sequence I
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1234

876) chain B
residue 517
type binding
ligand CLA: CHLOROPHYLL A
sequence H
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1234

877) chain B
residue 520
type binding
ligand CLA: CHLOROPHYLL A
sequence I
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1234

878) chain B
residue 524
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1234

879) chain B
residue 587
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1234

880) chain B
residue 590-591
type binding
ligand CLA: CHLOROPHYLL A
sequence YW
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1234

881) chain B
residue 594-595
type binding
ligand CLA: CHLOROPHYLL A
sequence KH
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1234

882) chain B
residue 416
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1236

883) chain B
residue 419-420
type binding
ligand CLA: CHLOROPHYLL A
sequence HL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1236

884) chain B
residue 422-423
type binding
ligand CLA: CHLOROPHYLL A
sequence WV
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1236

885) chain B
residue 520-521
type binding
ligand CLA: CHLOROPHYLL A
sequence IA
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1236

886) chain B
residue 524-525
type binding
ligand CLA: CHLOROPHYLL A
sequence LH
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1236

887) chain B
residue 528
type binding
ligand CLA: CHLOROPHYLL A
sequence A
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1236

888) chain B
residue 532
type binding
ligand CLA: CHLOROPHYLL A
sequence I
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1236

889) chain B
residue 422
type binding
ligand CLA: CHLOROPHYLL A
sequence W
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1229

890) chain B
residue 425-426
type binding
ligand CLA: CHLOROPHYLL A
sequence LF
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1229

891) chain B
residue 429-430
type binding
ligand CLA: CHLOROPHYLL A
sequence FH
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1229

892) chain B
residue 423
type binding
ligand CLA: CHLOROPHYLL A
sequence V
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1235

893) chain B
residue 426-427
type binding
ligand CLA: CHLOROPHYLL A
sequence FL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1235

894) chain B
residue 453-459
type binding
ligand CLA: CHLOROPHYLL A
sequence IEPVFAQ
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1235

895) chain B
residue 509
type binding
ligand CLA: CHLOROPHYLL A
sequence I
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1235

896) chain B
residue 513-514
type binding
ligand CLA: CHLOROPHYLL A
sequence DF
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1235

897) chain B
residue 517-518
type binding
ligand CLA: CHLOROPHYLL A
sequence HH
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1235

898) chain B
residue 521
type binding
ligand CLA: CHLOROPHYLL A
sequence A
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1235

899) chain B
residue 525
type binding
ligand CLA: CHLOROPHYLL A
sequence H
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1235

900) chain B
residue 426-427
type binding
ligand C7Z: (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol
sequence FL
description (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol binding site
source pdb_hetatom : C7Z_6hqb_J_4015

901) chain B
residue 430-431
type binding
ligand C7Z: (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol
sequence HT
description (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol binding site
source pdb_hetatom : C7Z_6hqb_J_4015

902) chain B
residue 434
type binding
ligand C7Z: (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol
sequence L
description (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol binding site
source pdb_hetatom : C7Z_6hqb_J_4015

903) chain B
residue 451
type binding
ligand C7Z: (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol
sequence I
description (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol binding site
source pdb_hetatom : C7Z_6hqb_J_4015

904) chain B
residue 453
type binding
ligand C7Z: (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol
sequence I
description (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol binding site
source pdb_hetatom : C7Z_6hqb_J_4015

905) chain B
residue 514
type binding
ligand C7Z: (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol
sequence F
description (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol binding site
source pdb_hetatom : C7Z_6hqb_J_4015

906) chain B
residue 518
type binding
ligand C7Z: (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol
sequence H
description (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol binding site
source pdb_hetatom : C7Z_6hqb_J_4015

907) chain B
residue 456-457
type binding
ligand CLA: CHLOROPHYLL A
sequence VF
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_F_1302

908) chain B
residue 460
type binding
ligand CLA: CHLOROPHYLL A
sequence W
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_F_1302

909) chain B
residue 472
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_F_1302

910) chain B
residue 460-461
type binding
ligand CLA: CHLOROPHYLL A
sequence WI
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1231

911) chain B
residue 464-465
type binding
ligand CLA: CHLOROPHYLL A
sequence TS
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1231

912) chain B
residue 475-476
type binding
ligand CLA: CHLOROPHYLL A
sequence LL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1231

913) chain B
residue 490-491
type binding
ligand CLA: CHLOROPHYLL A
sequence WL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1231

914) chain B
residue 494
type binding
ligand CLA: CHLOROPHYLL A
sequence W
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1231

915) chain B
residue 506
type binding
ligand CLA: CHLOROPHYLL A
sequence F
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1231

916) chain B
residue 475
type binding
ligand LHG: 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
sequence L
description 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE binding site
source pdb_hetatom : LHG_6hqb_B_5006

917) chain B
residue 478
type binding
ligand LHG: 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
sequence N
description 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE binding site
source pdb_hetatom : LHG_6hqb_B_5006

918) chain B
residue 480-483
type binding
ligand LHG: 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
sequence DSIA
description 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE binding site
source pdb_hetatom : LHG_6hqb_B_5006

919) chain B
residue 475
type binding
ligand CLA: CHLOROPHYLL A
sequence L
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1232

920) chain B
residue 481-483
type binding
ligand CLA: CHLOROPHYLL A
sequence SIA
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1232

921) chain B
residue 486
type binding
ligand CLA: CHLOROPHYLL A
sequence T
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1232

922) chain B
residue 488
type binding
ligand CLA: CHLOROPHYLL A
sequence A
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1232

923) chain B
residue 490
type binding
ligand CLA: CHLOROPHYLL A
sequence W
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_B_1232

924) chain B
residue 682-685
type binding
ligand EQ3: (3'R)-3'-hydroxy-beta,beta-caroten-4-one
sequence TPLA
description (3'R)-3'-hydroxy-beta,beta-caroten-4-one binding site
source pdb_hetatom : EQ3_6hqb_I_4020

925) chain B
residue 683-684
type binding
ligand CLA: CHLOROPHYLL A
sequence PL
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_L_1502

926) chain B
residue 687-688
type binding
ligand CLA: CHLOROPHYLL A
sequence LV
description CHLOROPHYLL A binding site
source pdb_hetatom : CLA_6hqb_L_1502


Display surface

Download
Links