|
eF-site ID
|
6hd7-n |
PDB Code
|
6hd7 |
Chain
|
n |
|
click to enlarge
|
|
Title
|
Cryo-EM structure of the ribosome-NatA complex |
Classification
|
TRANSLATION |
Compound
|
Saccharomyces cerevisiae S288C 35S pre-ribosomal RNA (RDN37-1), miscRNA |
Source
|
ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae; |
|
Sequence
|
n: |
AAQKSFRIKQKMAKAKKQNRPLPQWIRLRTNNTIRYNAKR
RNWRRTKMNI
|
|
Description
|
(1) |
60S ribosomal protein L42-A, 60S ribosomal protein L43-A, 60S ribosomal protein L2-A, 60S ribosomal protein L3, 60S ribosomal protein L4-A, 60S ribosomal protein L5, 60S ribosomal protein L6-A, 60S ribosomal protein L7-A, 60S ribosomal protein L8-A, 60S ribosomal protein L9-A, 60S ribosomal protein L11-A, 60S ribosomal protein L13-A, 60S ribosomal protein L14-A, 60S ribosomal protein L15-A, 60S ribosomal protein L16-A, 60S ribosomal protein L17-A, 60S ribosomal protein L18-A, 60S ribosomal protein L19-A, 60S ribosomal protein L20-A, 60S ribosomal protein L21-A, 60S ribosomal protein L22-A, 60S ribosomal protein L23-A, 60S ribosomal protein L24-A, 60S ribosomal protein L25, 60S ribosomal protein L26-A, 60S ribosomal protein L27-A, 60S ribosomal protein L28, 60S ribosomal protein L29, 60S ribosomal protein L30, 60S ribosomal protein L31-A, 60S ribosomal protein L32, 60S ribosomal protein L33-A, 60S ribosomal protein L34-A, 60S ribosomal protein L35-A, 60S ribosomal protein L36-A, 60S ribosomal protein L37-A, 60S ribosomal protein L38, 60S ribosomal protein L39, Ubiquitin-60S ribosomal protein L40, 60S ribosomal protein L41-A, ribosomal protein RPL1, 60S ribosomal protein L10, N-terminal acetyltransferase A complex subunit NAT1, N-terminal acetyltransferase A complex catalytic subunit ARD1, N-alpha-acetyltransferase NAT5, nascent polypeptide chain/RNA Complex
|
|
Functional site
|
|
1)
|
chain |
n |
residue |
30-46 |
type |
prosite |
sequence |
RTNNTIRYNAKRRNWRR
|
description |
RIBOSOMAL_L39E Ribosomal protein L39e signature. RTnntIryNakrRNWRR
|
source |
prosite : PS00051
|
|
|
|