eF-site ID 6hd7-c
PDB Code 6hd7
Chain c

click to enlarge
Title Cryo-EM structure of the ribosome-NatA complex
Classification TRANSLATION
Compound Saccharomyces cerevisiae S288C 35S pre-ribosomal RNA (RDN37-1), miscRNA
Source ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae;
Sequence c:  PSRFTKTRKHRGHVSAGKGRIGKHRKHPGGRGMAGGQHHH
RINMDKYHPGYFGKVGMRYFHKQQAHFWKPVLNLDKLWTL
IPEDKRDQYLKSASKETAPVIDTLAAGYGKILGKGRIPNV
PVIVKARFVSKLAEEKIRAAGGVVELIA
Description (1)  60S ribosomal protein L42-A, 60S ribosomal protein L43-A, 60S ribosomal protein L2-A, 60S ribosomal protein L3, 60S ribosomal protein L4-A, 60S ribosomal protein L5, 60S ribosomal protein L6-A, 60S ribosomal protein L7-A, 60S ribosomal protein L8-A, 60S ribosomal protein L9-A, 60S ribosomal protein L11-A, 60S ribosomal protein L13-A, 60S ribosomal protein L14-A, 60S ribosomal protein L15-A, 60S ribosomal protein L16-A, 60S ribosomal protein L17-A, 60S ribosomal protein L18-A, 60S ribosomal protein L19-A, 60S ribosomal protein L20-A, 60S ribosomal protein L21-A, 60S ribosomal protein L22-A, 60S ribosomal protein L23-A, 60S ribosomal protein L24-A, 60S ribosomal protein L25, 60S ribosomal protein L26-A, 60S ribosomal protein L27-A, 60S ribosomal protein L28, 60S ribosomal protein L29, 60S ribosomal protein L30, 60S ribosomal protein L31-A, 60S ribosomal protein L32, 60S ribosomal protein L33-A, 60S ribosomal protein L34-A, 60S ribosomal protein L35-A, 60S ribosomal protein L36-A, 60S ribosomal protein L37-A, 60S ribosomal protein L38, 60S ribosomal protein L39, Ubiquitin-60S ribosomal protein L40, 60S ribosomal protein L41-A, ribosomal protein RPL1, 60S ribosomal protein L10, N-terminal acetyltransferase A complex subunit NAT1, N-terminal acetyltransferase A complex catalytic subunit ARD1, N-alpha-acetyltransferase NAT5, nascent polypeptide chain/RNA Complex


Functional site

1) chain c
residue 111-142
type prosite
sequence KILGKGRIPNVPVIVKARFVSKLAEEKIRAAG
description RIBOSOMAL_L15 Ribosomal protein L15 signature. KILGkGrIpnvp.ViVkarfVSklAeekIraaG
source prosite : PS00475


Display surface

Download
Links