eF-site ID 6hd7-C
PDB Code 6hd7
Chain C

click to enlarge
Title Cryo-EM structure of the ribosome-NatA complex
Classification TRANSLATION
Compound Saccharomyces cerevisiae S288C 35S pre-ribosomal RNA (RDN37-1), miscRNA
Source ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae;
Sequence C:  VNVPKTRKTYCKGKTCRKHTQHKVTQYKAGKASLFAQGKR
RYDRKQSGFGGQTKPVFHKKAKTTKKVVLRLECVKCKTRA
QLTLKRCKHFELGGEKKQKGQALQF
Description (1)  60S ribosomal protein L42-A, 60S ribosomal protein L43-A, 60S ribosomal protein L2-A, 60S ribosomal protein L3, 60S ribosomal protein L4-A, 60S ribosomal protein L5, 60S ribosomal protein L6-A, 60S ribosomal protein L7-A, 60S ribosomal protein L8-A, 60S ribosomal protein L9-A, 60S ribosomal protein L11-A, 60S ribosomal protein L13-A, 60S ribosomal protein L14-A, 60S ribosomal protein L15-A, 60S ribosomal protein L16-A, 60S ribosomal protein L17-A, 60S ribosomal protein L18-A, 60S ribosomal protein L19-A, 60S ribosomal protein L20-A, 60S ribosomal protein L21-A, 60S ribosomal protein L22-A, 60S ribosomal protein L23-A, 60S ribosomal protein L24-A, 60S ribosomal protein L25, 60S ribosomal protein L26-A, 60S ribosomal protein L27-A, 60S ribosomal protein L28, 60S ribosomal protein L29, 60S ribosomal protein L30, 60S ribosomal protein L31-A, 60S ribosomal protein L32, 60S ribosomal protein L33-A, 60S ribosomal protein L34-A, 60S ribosomal protein L35-A, 60S ribosomal protein L36-A, 60S ribosomal protein L37-A, 60S ribosomal protein L38, 60S ribosomal protein L39, Ubiquitin-60S ribosomal protein L40, 60S ribosomal protein L41-A, ribosomal protein RPL1, 60S ribosomal protein L10, N-terminal acetyltransferase A complex subunit NAT1, N-terminal acetyltransferase A complex catalytic subunit ARD1, N-alpha-acetyltransferase NAT5, nascent polypeptide chain/RNA Complex


Functional site

1) chain C
residue 56
type
sequence P
description binding site for residue 3HE 1 3401
source : AC1

2) chain C
residue 63-74
type prosite
sequence KTTKKVVLRLEC
description RIBOSOMAL_L44E Ribosomal protein L44e signature. KtTKKvvLRleC
source prosite : PS01172


Display surface

Download
Links