eF-site ID 6hbl-T
PDB Code 6hbl
Chain T

click to enlarge
Title Echovirus 18 Open particle without three pentamers
Classification VIRUS
Compound Echovirus 18 capsid protein 1
Source ORGANISM_SCIENTIFIC: Echovirus E18;
Sequence T:  VRSMTLGNSTITTQNVVVGYGEWPSYLSTAEDQPTQPDVA
TCRFYTLESVQWEKTSPGWWWKFPEALKNMGLFGQNMHYH
YLGRAGYTIHVQCNASKFHQGCLLVVCVPEAEMGCADTDT
TFPATELTTEDTPHVFTSDSITGKKVQAAVCNAGMGVGVG
NLTIFPHQWINLRTNNSATIVIPYINSVPMDNMFRHYNFT
LMIIPFAPLNFTDGATAYVPITVTIAPMYAEYNGLRLA
Description (1)  Echovirus 18 viral capsid proteins

Display surface

Download
Links