eF-site ID 6ha7-A PDB Code 6ha7 Chain A click to enlarge Title Crystal structure of the BiP NBD and MANF complex Classification CHAPERONE Compound Endoplasmic reticulum chaperone BiP Source (MANF_MOUSE) Sequence A:  SGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYV AFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDP SVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEIS AMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKD AGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLG GGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHF IKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQAR IEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVL EDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSR GINPDEAVAYGAAVQAGVLS Description Functional site 1) chain A residue 34 type sequence D description binding site for residue EDO A 501 source : AC1 2) chain A residue 36 type sequence G description binding site for residue EDO A 501 source : AC1 3) chain A residue 394 type sequence V description binding site for residue EDO A 501 source : AC1 4) chain A residue 353 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternate => ECO:0000250|UniProtKB:P11021 source Swiss-Prot : SWS_FT_FI9 5) chain A residue 96 type BINDING sequence K description BINDING => ECO:0000250|UniProtKB:P11021 source Swiss-Prot : SWS_FT_FI2 6) chain A residue 293 type MOD_RES sequence E description Phosphotyrosine => ECO:0007744|PubMed:18034455 source Swiss-Prot : SWS_FT_FI1 7) chain A residue 364 type MOD_RES sequence G description Phosphotyrosine => ECO:0007744|PubMed:18034455 source Swiss-Prot : SWS_FT_FI1 8) chain A residue 86 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P06761 source Swiss-Prot : SWS_FT_FI3 9) chain A residue 125 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P20029 source Swiss-Prot : SWS_FT_FI4 10) chain A residue 213 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P20029 source Swiss-Prot : SWS_FT_FI4 11) chain A residue 326 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P20029 source Swiss-Prot : SWS_FT_FI4 12) chain A residue 160 type MOD_RES sequence Y description 3'-nitrotyrosine => ECO:0000250|UniProtKB:P20029 source Swiss-Prot : SWS_FT_FI5 13) chain A residue 271 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P0DMV8 source Swiss-Prot : SWS_FT_FI6 14) chain A residue 353 type MOD_RES sequence K description N6-acetyllysine; alternate => ECO:0000250|UniProtKB:P20029 source Swiss-Prot : SWS_FT_FI7 15) chain A residue 352 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0000250|UniProtKB:P11021 source Swiss-Prot : SWS_FT_FI8 16) chain A residue 33-40 type prosite sequence IDLGTTYS description HSP70_1 Heat shock hsp70 proteins family signature 1. IDLGTTyS source prosite : PS00297 17) chain A residue 222-235 type prosite sequence VFDLGGGTFDVSLL description HSP70_2 Heat shock hsp70 proteins family signature 2. VFDLGGGTfdvSLL source prosite : PS00329 18) chain A residue 359-373 type prosite sequence IVLVGGSTRIPKIQQ description HSP70_3 Heat shock hsp70 proteins family signature 3. IvLvGGsTRIPkIqQ source prosite : PS01036

Display surface Download Links