eF-site ID 6h4o-D
PDB Code 6h4o
Chain D

click to enlarge
Title Crystal structure of human KDM4A in complex with compound 18a
Classification OXIDOREDUCTASE
Compound Lysine-specific demethylase 4A
Source (KDM4A_HUMAN)
Sequence D:  ESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAG
LAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFT
QYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWK
NLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEGV
NTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSV
PPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLK
KYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNF
ATRRWIEYGKQAVLCSCMVKISMDVFVRKFQPERYKLWKA
GKDNTVIDHTLPTPEAAEFL
Description (1)  Lysine-specific demethylase 4A (E.C.1.14.11.-)


Functional site

1) chain D
residue 75
type
ligand
sequence V
description binding site for residue GOL B 404
source : AC9

2) chain D
residue 76
type
ligand
sequence T
description binding site for residue GOL B 404
source : AC9

3) chain D
residue 77
type
ligand
sequence G
description binding site for residue GOL B 404
source : AC9

4) chain D
residue 126
type
ligand
sequence T
description binding site for residue GOL B 404
source : AC9

5) chain D
residue 127
type
ligand
sequence F
description binding site for residue GOL B 404
source : AC9

6) chain D
residue 188
type
ligand
sequence H
description binding site for residue ZN D 401
source : AD7

7) chain D
residue 190
type
ligand
sequence E
description binding site for residue ZN D 401
source : AD7

8) chain D
residue 276
type
ligand
sequence H
description binding site for residue ZN D 401
source : AD7

9) chain D
residue 234
type
ligand
sequence C
description binding site for residue ZN D 402
source : AD8

10) chain D
residue 240
type
ligand
sequence H
description binding site for residue ZN D 402
source : AD8

11) chain D
residue 306
type
ligand
sequence C
description binding site for residue ZN D 402
source : AD8

12) chain D
residue 308
type
ligand
sequence C
description binding site for residue ZN D 402
source : AD8

13) chain D
residue 132
type
ligand
sequence Y
description binding site for residue FQH D 403
source : AD9

14) chain D
residue 135
type
ligand
sequence D
description binding site for residue FQH D 403
source : AD9

15) chain D
residue 177
type
ligand
sequence Y
description binding site for residue FQH D 403
source : AD9

16) chain D
residue 185
type
ligand
sequence F
description binding site for residue FQH D 403
source : AD9

17) chain D
residue 188
type
ligand
sequence H
description binding site for residue FQH D 403
source : AD9

18) chain D
residue 190
type
ligand
sequence E
description binding site for residue FQH D 403
source : AD9

19) chain D
residue 206
type
ligand
sequence K
description binding site for residue FQH D 403
source : AD9

20) chain D
residue 208
type
ligand
sequence W
description binding site for residue FQH D 403
source : AD9

21) chain D
residue 276
type
ligand
sequence H
description binding site for residue FQH D 403
source : AD9

22) chain D
residue 193
type
ligand
sequence D
description binding site for residue DMS D 404
source : AE1

23) chain D
residue 217
type
ligand
sequence K
description binding site for residue DMS D 404
source : AE1

24) chain D
residue 273
type
ligand
sequence Y
description binding site for residue DMS D 404
source : AE1

25) chain D
residue 299
type
ligand
sequence Y
description binding site for residue DMS D 404
source : AE1

26) chain D
residue 302
type
ligand
sequence Q
description binding site for residue DMS D 404
source : AE1

27) chain D
residue 343
type
ligand
sequence H
description binding site for residue DMS D 404
source : AE1


Display surface

Download
Links