eF-site ID 6h23-M PDB Code 6h23 Chain M click to enlarge Title Crystal structure of the hClpP Y118A mutant with an activating small molecule Classification HYDROLASE Compound ATP-dependent Clp protease proteolytic subunit, mitochondrial Source (CLPP_HUMAN) Sequence M:  YDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNK KPIHMAINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAA SMGSLLLAAGTPGMRHSLPNSRIMIHQPIAIQAEEIMKLK KQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILD KVLVHP Description (1)  ATP-dependent Clp protease proteolytic subunit, mitochondrial (E.C.3.4.21.92) Functional site 1) chain M residue 79 type sequence L description binding site for residue FJT M 301 source : AD7 2) chain M residue 82 type sequence E description binding site for residue FJT M 301 source : AD7 3) chain M residue 84 type sequence I description binding site for residue FJT M 301 source : AD7 4) chain M residue 146 type sequence W description binding site for residue FJT M 301 source : AD7 5) chain M residue 148 type sequence V description binding site for residue FJT M 301 source : AD7 6) chain M residue 101 type sequence A description binding site for residue FJT M 302 source : AD8 7) chain M residue 104 type sequence L description binding site for residue FJT M 302 source : AD8 8) chain M residue 105 type sequence F description binding site for residue FJT M 302 source : AD8 9) chain M residue 108 type sequence S description binding site for residue FJT M 302 source : AD8 10) chain M residue 138 type sequence Y description binding site for residue FJT M 302 source : AD8 11) chain M residue 153 type ACT_SITE sequence S description Nucleophile => ECO:0000269|PubMed:11923310 source Swiss-Prot : SWS_FT_FI1 12) chain M residue 178 type ACT_SITE sequence H description ACT_SITE => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 13) chain M residue 200 type MOD_RES sequence K description N6-succinyllysine => ECO:0000250|UniProtKB:O88696 source Swiss-Prot : SWS_FT_FI3 14) chain M residue 211 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links