eF-site ID 6h1y-AB PDB Code 6h1y Chain A, B click to enlarge Title CRYSTAL STRUCTURE OF A CHIMERIC VARIANT OF THIOREDOXIN FROM ESCHERICHIA COLI Classification OXIDOREDUCTASE Compound Thioredoxin 1,Thioredoxin (TrxA-1),Thioredoxin 1 Source (THIO_ECOLI) Sequence A:  SDKIIHLTDDSFDEVIRNNKLILVDFWAEWCGPCKMIAPI LDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLF KNGEVAATKVGALSKGQLKEFLDANLA B:  SDKIIHLTDDSFDEVIRNNKLILVDFWAEWCGPCKMIAPI LDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLF KNGEVAATKVGALSKGQLKEFLDANLA Description Functional site 1) chain A residue 31 type ACT_SITE sequence C description Nucleophile source Swiss-Prot : SWS_FT_FI1 2) chain A residue 34 type ACT_SITE sequence C description Nucleophile source Swiss-Prot : SWS_FT_FI1 3) chain B residue 31 type ACT_SITE sequence C description Nucleophile source Swiss-Prot : SWS_FT_FI1 4) chain B residue 34 type ACT_SITE sequence C description Nucleophile source Swiss-Prot : SWS_FT_FI1 5) chain A residue 25 type SITE sequence D description Deprotonates C-terminal active site Cys source Swiss-Prot : SWS_FT_FI2 6) chain B residue 25 type SITE sequence D description Deprotonates C-terminal active site Cys source Swiss-Prot : SWS_FT_FI2 7) chain A residue 32 type SITE sequence G description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 8) chain A residue 33 type SITE sequence P description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 9) chain B residue 32 type SITE sequence G description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 10) chain B residue 33 type SITE sequence P description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 11) chain A residue 68 type MOD_RES sequence K description N6-acetyllysine => ECO:0000269|PubMed:18723842 source Swiss-Prot : SWS_FT_FI4 12) chain B residue 68 type MOD_RES sequence K description N6-acetyllysine => ECO:0000269|PubMed:18723842 source Swiss-Prot : SWS_FT_FI4 13) chain A residue 23-41 type prosite sequence LVDFWAEWCGPCKMIAPIL description THIOREDOXIN_1 Thioredoxin family active site. LVdFWaeWCGPCKmIapiL source prosite : PS00194

Display surface Download Links