eF-site ID 6gzw-AB
PDB Code 6gzw
Chain A, B

click to enlarge
Title Ferric DtpA from Streptomyces lividans
Classification OXIDOREDUCTASE
Compound Dye type peroxidase A
Source (A0A076MAJ9_STRLI)
Sequence A:  ATPLTSLGSEQAMFHGKHQPGITTPMQARGHLVAFDLAAG
AGRKEAAALLRRWSDTARRLMAGEPAGSRDTDVARDAGPS
SLTVTFGFGHSFFGRTGLEKQRPVALDPLPDFSSDHLDKN
RSNGDLWVQIGADDALVAFHALRAIQRDAGAAARVRWQMN
GFNRSPGATAHPMTARNLMGQVDGTRNPKPGEADFDRRIF
VPEGPAWMANGSYVVVRRIRMLLDDWEELSLKAQEDVIGR
RKSDGAPLSGGSGATESTEMDLEKTDGSGELVVPINAHAR
ITRPDQNGGAAMVRRPFSYHDGFDADGVPDAGLLFVCWQA
DPLRGFVPVQRKLDRGDALSQFIRHEASGLFAVPGGAAEG
EYVGQRLLEG
B:  ATPLTSLGSEQAMFHGKHQPGITTPMQARGHLVAFDLAAG
AGRKEAAALLRRWSDTARRLMAGEPAGSRDTDVARDAGPS
SLTVTFGFGHSFFGRTGLEKQRPVALDPLPDFSSDHLDKN
RSNGDLWVQIGADDALVAFHALRAIQRDAGAAARVRWQMN
GFNRSPGATAHPMTARNLMGQVDGTRNPKPGEADFDRRIF
VPEPPAWMANGSYVVVRRIRMLLDDWEELSLKAQEDVIGR
RKSDGAPLSGGSGATESTEMDLEKTDGSGELVVPINAHAR
ITRPDQNGGAAMVRRPFSYHDGFDADGVPDAGLLFVCWQA
DPLRGFVPVQRKLDRGDALSQFIRHEASGLFAVPGGAAEG
EYVGQRLLEG
Description (1)  DtpA


Functional site

1) chain A
residue 245
type
ligand
sequence N
description binding site for residue HEM A 501
source : AC1

2) chain A
residue 249
type
ligand
sequence Q
description binding site for residue HEM A 501
source : AC1

3) chain A
residue 250
type
ligand
sequence V
description binding site for residue HEM A 501
source : AC1

4) chain A
residue 252
type
ligand
sequence G
description binding site for residue HEM A 501
source : AC1

5) chain A
residue 253
type
ligand
sequence T
description binding site for residue HEM A 501
source : AC1

6) chain A
residue 254
type
ligand
sequence R
description binding site for residue HEM A 501
source : AC1

7) chain A
residue 353
type
ligand
sequence H
description binding site for residue HEM A 501
source : AC1

8) chain A
residue 357
type
ligand
sequence T
description binding site for residue HEM A 501
source : AC1

9) chain A
residue 358
type
ligand
sequence R
description binding site for residue HEM A 501
source : AC1

10) chain A
residue 359
type
ligand
sequence P
description binding site for residue HEM A 501
source : AC1

11) chain A
residue 369
type
ligand
sequence R
description binding site for residue HEM A 501
source : AC1

12) chain A
residue 390
type
ligand
sequence F
description binding site for residue HEM A 501
source : AC1

13) chain A
residue 401
type
ligand
sequence F
description binding site for residue HEM A 501
source : AC1

14) chain A
residue 405
type
ligand
sequence Q
description binding site for residue HEM A 501
source : AC1

15) chain A
residue 414
type
ligand
sequence L
description binding site for residue HEM A 501
source : AC1

16) chain B
residue 245
type
ligand
sequence N
description binding site for residue HEM B 501
source : AC2

17) chain B
residue 249
type
ligand
sequence Q
description binding site for residue HEM B 501
source : AC2

18) chain B
residue 250
type
ligand
sequence V
description binding site for residue HEM B 501
source : AC2

19) chain B
residue 251
type
ligand
sequence D
description binding site for residue HEM B 501
source : AC2

20) chain B
residue 252
type
ligand
sequence G
description binding site for residue HEM B 501
source : AC2

21) chain B
residue 253
type
ligand
sequence T
description binding site for residue HEM B 501
source : AC2

22) chain B
residue 254
type
ligand
sequence R
description binding site for residue HEM B 501
source : AC2

23) chain B
residue 294
type
ligand
sequence I
description binding site for residue HEM B 501
source : AC2

24) chain B
residue 353
type
ligand
sequence H
description binding site for residue HEM B 501
source : AC2

25) chain B
residue 357
type
ligand
sequence T
description binding site for residue HEM B 501
source : AC2

26) chain B
residue 358
type
ligand
sequence R
description binding site for residue HEM B 501
source : AC2

27) chain B
residue 359
type
ligand
sequence P
description binding site for residue HEM B 501
source : AC2

28) chain B
residue 369
type
ligand
sequence R
description binding site for residue HEM B 501
source : AC2

29) chain B
residue 390
type
ligand
sequence F
description binding site for residue HEM B 501
source : AC2

30) chain B
residue 401
type
ligand
sequence F
description binding site for residue HEM B 501
source : AC2

31) chain B
residue 414
type
ligand
sequence L
description binding site for residue HEM B 501
source : AC2

32) chain A
residue 245
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence N
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_A_501

33) chain A
residue 247
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence M
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_A_501

34) chain A
residue 249-255
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence QVDGTRN
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_A_501

35) chain A
residue 294
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_A_501

36) chain A
residue 296
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence M
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_A_501

37) chain A
residue 313
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_A_501

38) chain A
residue 315
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence R
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_A_501

39) chain A
residue 353-354
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence HA
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_A_501

40) chain A
residue 357-359
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence TRP
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_A_501

41) chain A
residue 367
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence M
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_A_501

42) chain A
residue 369
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence R
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_A_501

43) chain A
residue 388
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence L
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_A_501

44) chain A
residue 390
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence F
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_A_501

45) chain A
residue 401
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence F
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_A_501

46) chain A
residue 404-405
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence VQ
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_A_501

47) chain A
residue 408
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence L
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_A_501

48) chain A
residue 414
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence L
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_A_501

49) chain A
residue 418
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_A_501

50) chain A
residue 420
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence H
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_A_501

51) chain B
residue 245
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence N
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_B_501

52) chain B
residue 247
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence M
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_B_501

53) chain B
residue 249-254
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence QVDGTR
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_B_501

54) chain B
residue 294
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_B_501

55) chain B
residue 296
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence M
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_B_501

56) chain B
residue 313
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_B_501

57) chain B
residue 315
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence R
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_B_501

58) chain B
residue 353-354
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence HA
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_B_501

59) chain B
residue 357-359
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence TRP
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_B_501

60) chain B
residue 367
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence M
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_B_501

61) chain B
residue 369
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence R
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_B_501

62) chain B
residue 388
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence L
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_B_501

63) chain B
residue 390
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence F
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_B_501

64) chain B
residue 401
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence F
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_B_501

65) chain B
residue 404-405
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence VQ
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_B_501

66) chain B
residue 408
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence L
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_B_501

67) chain B
residue 414
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence L
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_B_501

68) chain B
residue 418
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_B_501

69) chain B
residue 420
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence H
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_6gzw_B_501


Display surface

Download
Links