eF-site ID 6gzw-AB
PDB Code 6gzw
Chain A, B

click to enlarge
Title Ferric DtpA from Streptomyces lividans
Classification OXIDOREDUCTASE
Compound Dye type peroxidase A
Source (A0A076MAJ9_STRLI)
Sequence A:  ATPLTSLGSEQAMFHGKHQPGITTPMQARGHLVAFDLAAG
AGRKEAAALLRRWSDTARRLMAGEPAGSRDTDVARDAGPS
SLTVTFGFGHSFFGRTGLEKQRPVALDPLPDFSSDHLDKN
RSNGDLWVQIGADDALVAFHALRAIQRDAGAAARVRWQMN
GFNRSPGATAHPMTARNLMGQVDGTRNPKPGEADFDRRIF
VPEGPAWMANGSYVVVRRIRMLLDDWEELSLKAQEDVIGR
RKSDGAPLSGGSGATESTEMDLEKTDGSGELVVPINAHAR
ITRPDQNGGAAMVRRPFSYHDGFDADGVPDAGLLFVCWQA
DPLRGFVPVQRKLDRGDALSQFIRHEASGLFAVPGGAAEG
EYVGQRLLEG
B:  ATPLTSLGSEQAMFHGKHQPGITTPMQARGHLVAFDLAAG
AGRKEAAALLRRWSDTARRLMAGEPAGSRDTDVARDAGPS
SLTVTFGFGHSFFGRTGLEKQRPVALDPLPDFSSDHLDKN
RSNGDLWVQIGADDALVAFHALRAIQRDAGAAARVRWQMN
GFNRSPGATAHPMTARNLMGQVDGTRNPKPGEADFDRRIF
VPEPPAWMANGSYVVVRRIRMLLDDWEELSLKAQEDVIGR
RKSDGAPLSGGSGATESTEMDLEKTDGSGELVVPINAHAR
ITRPDQNGGAAMVRRPFSYHDGFDADGVPDAGLLFVCWQA
DPLRGFVPVQRKLDRGDALSQFIRHEASGLFAVPGGAAEG
EYVGQRLLEG
Description (1)  DtpA


Functional site

1) chain A
residue 245
type
ligand
sequence N
description binding site for residue HEM A 501
source : AC1

2) chain A
residue 249
type
ligand
sequence Q
description binding site for residue HEM A 501
source : AC1

3) chain A
residue 250
type
ligand
sequence V
description binding site for residue HEM A 501
source : AC1

4) chain A
residue 252
type
ligand
sequence G
description binding site for residue HEM A 501
source : AC1

5) chain A
residue 253
type
ligand
sequence T
description binding site for residue HEM A 501
source : AC1

6) chain A
residue 254
type
ligand
sequence R
description binding site for residue HEM A 501
source : AC1

7) chain A
residue 353
type
ligand
sequence H
description binding site for residue HEM A 501
source : AC1

8) chain A
residue 357
type
ligand
sequence T
description binding site for residue HEM A 501
source : AC1

9) chain A
residue 358
type
ligand
sequence R
description binding site for residue HEM A 501
source : AC1

10) chain A
residue 359
type
ligand
sequence P
description binding site for residue HEM A 501
source : AC1

11) chain A
residue 369
type
ligand
sequence R
description binding site for residue HEM A 501
source : AC1

12) chain A
residue 390
type
ligand
sequence F
description binding site for residue HEM A 501
source : AC1

13) chain A
residue 401
type
ligand
sequence F
description binding site for residue HEM A 501
source : AC1

14) chain A
residue 405
type
ligand
sequence Q
description binding site for residue HEM A 501
source : AC1

15) chain A
residue 414
type
ligand
sequence L
description binding site for residue HEM A 501
source : AC1

16) chain B
residue 245
type
ligand
sequence N
description binding site for residue HEM B 501
source : AC2

17) chain B
residue 249
type
ligand
sequence Q
description binding site for residue HEM B 501
source : AC2

18) chain B
residue 250
type
ligand
sequence V
description binding site for residue HEM B 501
source : AC2

19) chain B
residue 251
type
ligand
sequence D
description binding site for residue HEM B 501
source : AC2

20) chain B
residue 252
type
ligand
sequence G
description binding site for residue HEM B 501
source : AC2

21) chain B
residue 253
type
ligand
sequence T
description binding site for residue HEM B 501
source : AC2

22) chain B
residue 254
type
ligand
sequence R
description binding site for residue HEM B 501
source : AC2

23) chain B
residue 294
type
ligand
sequence I
description binding site for residue HEM B 501
source : AC2

24) chain B
residue 353
type
ligand
sequence H
description binding site for residue HEM B 501
source : AC2

25) chain B
residue 357
type
ligand
sequence T
description binding site for residue HEM B 501
source : AC2

26) chain B
residue 358
type
ligand
sequence R
description binding site for residue HEM B 501
source : AC2

27) chain B
residue 359
type
ligand
sequence P
description binding site for residue HEM B 501
source : AC2

28) chain B
residue 369
type
ligand
sequence R
description binding site for residue HEM B 501
source : AC2

29) chain B
residue 390
type
ligand
sequence F
description binding site for residue HEM B 501
source : AC2

30) chain B
residue 401
type
ligand
sequence F
description binding site for residue HEM B 501
source : AC2

31) chain B
residue 414
type
ligand
sequence L
description binding site for residue HEM B 501
source : AC2


Display surface

Download
Links