eF-site ID 6gws-A PDB Code 6gws Chain A click to enlarge Title Crystal structure of human PCNA in complex with three p15 peptides Classification REPLICATION Compound Proliferating cell nuclear antigen Source (PAF15_HUMAN) Sequence A:  MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSM DSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILK CAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD LDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVI SCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMN EPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYK IADMGHLKYYLAPKI Description Functional site 1) chain A residue 254 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI6 2) chain A residue 211 type MOD_RES sequence Y description Phosphotyrosine; by EGFR => ECO:0000269|PubMed:17115032 source Swiss-Prot : SWS_FT_FI4 3) chain A residue 164 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate => ECO:0000269|PubMed:17108083, ECO:0000269|PubMed:17130289 source Swiss-Prot : SWS_FT_FI5 4) chain A residue 61-79 type prosite sequence RCDRNLAMGVNLTSMSKIL description PCNA_2 Proliferating cell nuclear antigen signature 2. RCDRnlaMgvnLtSMsKIL source prosite : PS00293 5) chain A residue 34-57 type prosite sequence GVNLQSMDSSHVSLVQLTLRSEGF description PCNA_1 Proliferating cell nuclear antigen signature 1. GVnLqSMDsSHVsLVqLtLrsegF source prosite : PS01251 6) chain A residue 14 type MOD_RES sequence K description N6-acetyllysine => ECO:0000269|PubMed:19419956 source Swiss-Prot : SWS_FT_FI2 7) chain A residue 77 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI3 8) chain A residue 80 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI3 9) chain A residue 248 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links