eF-site ID 6gop-b PDB Code 6gop Chain b click to enlarge Title Yeast 20S Proteasome in complex with Homosalinosporamide A Classification HYDROLASE Compound Proteasome subunit alpha type-2 Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae (strain ATCC 204508 / S288c); Sequence b:  TSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDK IWCCRSGSAADTQAIADIVQYHLELYTSQYGTPSTETAAS VFKELCYENKDNLTAGIIVAGYDDKNKGEVYTIPLGGSVH KLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLS QAIKWDGSSGGVIRMVVLTAAGVERLIFYPDEYEQL Description Functional site 1) chain b residue 45 type sequence R description binding site for residue CL b 202 source : AD5 2) chain b residue 53 type sequence Q description binding site for residue CL b 202 source : AD5 3) chain b residue 2 type sequence S description binding site for Di-peptide F6K b 201 and THR b 1 source : AD8 4) chain b residue 17 type sequence D description binding site for Di-peptide F6K b 201 and THR b 1 source : AD8 5) chain b residue 19 type sequence R description binding site for Di-peptide F6K b 201 and THR b 1 source : AD8 6) chain b residue 20 type sequence T description binding site for Di-peptide F6K b 201 and THR b 1 source : AD8 7) chain b residue 21 type sequence T description binding site for Di-peptide F6K b 201 and THR b 1 source : AD8 8) chain b residue 23 type sequence G description binding site for Di-peptide F6K b 201 and THR b 1 source : AD8 9) chain b residue 33 type sequence K description binding site for Di-peptide F6K b 201 and THR b 1 source : AD8 10) chain b residue 45 type sequence R description binding site for Di-peptide F6K b 201 and THR b 1 source : AD8 11) chain b residue 46 type sequence S description binding site for Di-peptide F6K b 201 and THR b 1 source : AD8 12) chain b residue 47 type sequence G description binding site for Di-peptide F6K b 201 and THR b 1 source : AD8 13) chain b residue 128 type sequence G description binding site for Di-peptide F6K b 201 and THR b 1 source : AD8 14) chain b residue 129 type sequence S description binding site for Di-peptide F6K b 201 and THR b 1 source : AD8 15) chain b residue 130 type sequence G description binding site for Di-peptide F6K b 201 and THR b 1 source : AD8 16) chain b residue 166 type sequence D description binding site for Di-peptide F6K b 201 and THR b 1 source : AD8 17) chain b residue 168 type sequence S description binding site for Di-peptide F6K b 201 and THR b 1 source : AD8 18) chain b residue 169 type sequence S description binding site for Di-peptide F6K b 201 and THR b 1 source : AD8 19) chain b residue 4-51 type prosite sequence MAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWC CRSGSAAD description PROTEASOME_BETA_1 Proteasome beta-type subunits signature. ISMkYdnGVIIAADnlgsygsllrfngve.RlipvgdntvvgisGdiSD source prosite : PS00854 20) chain b residue 1 type ACT_SITE sequence T description Nucleophile => ECO:0000269|PubMed:9087403 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links