eF-site ID 6gjq-E
PDB Code 6gjq
Chain E

click to enlarge
Title human NBD1 of CFTR in complex with nanobody T27
Classification HYDROLASE
Compound Cystic fibrosis transmembrane conductance regulator
Source (6GJQ)
Sequence E:  DINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSRISF
CPQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDI
SKFPEKDNTVLGEGGITLSGGQRARISLARAVYKDADLYL
LDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHL
KKADKILILHEGSSYFYGTFSELQNLQ
Description (1)  Cystic fibrosis transmembrane conductance regulator (E.C.3.6.3.49), Nanobody T27


Functional site

1) chain E
residue 495
type
ligand
sequence S
description binding site for residue ATP A 701
source : AC1

2) chain E
residue 443
type
ligand
sequence D
description binding site for residue ATP E 701
source : AC3

3) chain E
residue 460
type
ligand
sequence T
description binding site for residue ATP E 701
source : AC3

4) chain E
residue 461
type
ligand
sequence G
description binding site for residue ATP E 701
source : AC3

5) chain E
residue 462
type
ligand
sequence A
description binding site for residue ATP E 701
source : AC3

6) chain E
residue 463
type
ligand
sequence G
description binding site for residue ATP E 701
source : AC3

7) chain E
residue 464
type
ligand
sequence K
description binding site for residue ATP E 701
source : AC3

8) chain E
residue 465
type
ligand
sequence T
description binding site for residue ATP E 701
source : AC3

9) chain E
residue 466
type
ligand
sequence S
description binding site for residue ATP E 701
source : AC3

10) chain E
residue 493
type
ligand
sequence Q
description binding site for residue ATP E 701
source : AC3

11) chain E
residue 494-497
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence FSWI
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_A_701

12) chain E
residue 553
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence R
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_A_701

13) chain E
residue 443
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence D
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_E_701

14) chain E
residue 459-466
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence STGAGKTS
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_E_701

15) chain E
residue 493
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence Q
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_E_701

16) chain E
residue 622
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence G
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_E_701


Display surface

Download
Links