eF-site ID 6gjq-ABCDEFGH
PDB Code 6gjq
Chain A, B, C, D, E, F, G, H

click to enlarge
Title human NBD1 of CFTR in complex with nanobody T27
Classification HYDROLASE
Compound Cystic fibrosis transmembrane conductance regulator
Source (6GJQ)
Sequence A:  DINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSRISF
CPQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDI
SKFPEKDNTVLGEGGITLSGGQRARISLARAVYKDADLYL
LDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHL
KKADKILILHEGSSYFYGTFSELQNLQ
B:  QVQLQESGGGLEQPGGSLRLSCATSGVIFGINAMGWYRQA
PGKQRELVATFTSGGSTNYADFVEGRFTISRDNAKNTVYL
QMNGLRPEDTAVYYCHATVVVSRYGLTYDYWGQGTQVTVS
S
C:  DINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSRISF
CPQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDI
SKFPEKDNTVLGEGGITLSGGQRARISLARAVYKDADLYL
LDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHL
KKADKILILHEGSSYFYGTFSELQNL
D:  QVQLQESGGGLEQPGGSLRLSCATSGVIFGINAMGWYRQA
PGKQRELVATFTSGGSTNYADFVEGRFTISRDNAKNTVYL
QMNGLRPEDTAVYYCHATVVVSRYGLTYDYWGQGTQVTVS
S
E:  DINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSRISF
CPQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDI
SKFPEKDNTVLGEGGITLSGGQRARISLARAVYKDADLYL
LDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHL
KKADKILILHEGSSYFYGTFSELQNLQ
F:  QVQLQESGGGLEQPGGSLRLSCATSGVIFGINAMGWYRQA
PGKQRELVATFTSGGSTNYADFVEGRFTISRDNAKNTVYL
QMNGLRPEDTAVYYCHATVVVSRYGLTYDYWGQGTQVTVS
S
G:  DINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSRISF
CPQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDI
SKFPEKDNTVLGEGGITLSGGQRARISLARAVYKDADLYL
LDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHL
KKADKILILHEGSSYFYGTFSELQNLQ
H:  QVQLQESGGGLEQPGGSLRLSCATSGVIFGINAMGWYRQA
PGKQRELVATFTSGGSTNYADFVEGRFTISRDNAKNTVYL
QMNGLRPEDTAVYYCHATVVVSRYGLTYDYWGQGTQVTVS
S
Description (1)  Cystic fibrosis transmembrane conductance regulator (E.C.3.6.3.49), Nanobody T27


Functional site

1) chain A
residue 459
type
ligand
sequence S
description binding site for residue ATP A 701
source : AC1

2) chain A
residue 460
type
ligand
sequence T
description binding site for residue ATP A 701
source : AC1

3) chain A
residue 461
type
ligand
sequence G
description binding site for residue ATP A 701
source : AC1

4) chain A
residue 462
type
ligand
sequence A
description binding site for residue ATP A 701
source : AC1

5) chain A
residue 463
type
ligand
sequence G
description binding site for residue ATP A 701
source : AC1

6) chain A
residue 464
type
ligand
sequence K
description binding site for residue ATP A 701
source : AC1

7) chain A
residue 465
type
ligand
sequence T
description binding site for residue ATP A 701
source : AC1

8) chain A
residue 466
type
ligand
sequence S
description binding site for residue ATP A 701
source : AC1

9) chain A
residue 493
type
ligand
sequence Q
description binding site for residue ATP A 701
source : AC1

10) chain E
residue 495
type
ligand
sequence S
description binding site for residue ATP A 701
source : AC1

11) chain C
residue 460
type
ligand
sequence T
description binding site for residue ATP C 701
source : AC2

12) chain C
residue 461
type
ligand
sequence G
description binding site for residue ATP C 701
source : AC2

13) chain C
residue 462
type
ligand
sequence A
description binding site for residue ATP C 701
source : AC2

14) chain C
residue 463
type
ligand
sequence G
description binding site for residue ATP C 701
source : AC2

15) chain C
residue 464
type
ligand
sequence K
description binding site for residue ATP C 701
source : AC2

16) chain C
residue 465
type
ligand
sequence T
description binding site for residue ATP C 701
source : AC2

17) chain C
residue 466
type
ligand
sequence S
description binding site for residue ATP C 701
source : AC2

18) chain C
residue 493
type
ligand
sequence Q
description binding site for residue ATP C 701
source : AC2

19) chain G
residue 495
type
ligand
sequence S
description binding site for residue ATP C 701
source : AC2

20) chain A
residue 494
type
ligand
sequence F
description binding site for residue ATP E 701
source : AC3

21) chain A
residue 495
type
ligand
sequence S
description binding site for residue ATP E 701
source : AC3

22) chain E
residue 443
type
ligand
sequence D
description binding site for residue ATP E 701
source : AC3

23) chain E
residue 460
type
ligand
sequence T
description binding site for residue ATP E 701
source : AC3

24) chain E
residue 461
type
ligand
sequence G
description binding site for residue ATP E 701
source : AC3

25) chain E
residue 462
type
ligand
sequence A
description binding site for residue ATP E 701
source : AC3

26) chain E
residue 463
type
ligand
sequence G
description binding site for residue ATP E 701
source : AC3

27) chain E
residue 464
type
ligand
sequence K
description binding site for residue ATP E 701
source : AC3

28) chain E
residue 465
type
ligand
sequence T
description binding site for residue ATP E 701
source : AC3

29) chain E
residue 466
type
ligand
sequence S
description binding site for residue ATP E 701
source : AC3

30) chain E
residue 493
type
ligand
sequence Q
description binding site for residue ATP E 701
source : AC3

31) chain C
residue 494
type
ligand
sequence F
description binding site for residue ATP G 701
source : AC4

32) chain C
residue 495
type
ligand
sequence S
description binding site for residue ATP G 701
source : AC4

33) chain C
residue 496
type
ligand
sequence W
description binding site for residue ATP G 701
source : AC4

34) chain G
residue 443
type
ligand
sequence D
description binding site for residue ATP G 701
source : AC4

35) chain G
residue 460
type
ligand
sequence T
description binding site for residue ATP G 701
source : AC4

36) chain G
residue 461
type
ligand
sequence G
description binding site for residue ATP G 701
source : AC4

37) chain G
residue 462
type
ligand
sequence A
description binding site for residue ATP G 701
source : AC4

38) chain G
residue 463
type
ligand
sequence G
description binding site for residue ATP G 701
source : AC4

39) chain G
residue 464
type
ligand
sequence K
description binding site for residue ATP G 701
source : AC4

40) chain G
residue 465
type
ligand
sequence T
description binding site for residue ATP G 701
source : AC4

41) chain G
residue 466
type
ligand
sequence S
description binding site for residue ATP G 701
source : AC4

42) chain G
residue 493
type
ligand
sequence Q
description binding site for residue ATP G 701
source : AC4

43) chain A
residue 443
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence D
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_A_701

44) chain A
residue 459-466
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence STGAGKTS
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_A_701

45) chain A
residue 493
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence Q
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_A_701

46) chain A
residue 572
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence D
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_A_701

47) chain A
residue 622
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence G
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_A_701

48) chain E
residue 494-497
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence FSWI
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_A_701

49) chain E
residue 553
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence R
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_A_701

50) chain A
residue 494-497
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence FSWI
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_E_701

51) chain A
residue 553
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence R
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_E_701

52) chain E
residue 443
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence D
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_E_701

53) chain E
residue 459-466
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence STGAGKTS
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_E_701

54) chain E
residue 493
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence Q
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_E_701

55) chain E
residue 622
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence G
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_E_701

56) chain C
residue 459-466
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence STGAGKTS
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_C_701

57) chain C
residue 493
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence Q
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_C_701

58) chain C
residue 572
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence D
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_C_701

59) chain C
residue 622
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence G
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_C_701

60) chain G
residue 443
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence D
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_G_701

61) chain G
residue 459-467
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence STGAGKTSL
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_G_701

62) chain G
residue 470
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence M
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_G_701

63) chain G
residue 493
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence Q
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_G_701

64) chain G
residue 622
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence G
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_G_701


Display surface

Download
Links