eF-site ID 6gjq-A
PDB Code 6gjq
Chain A

click to enlarge
Title human NBD1 of CFTR in complex with nanobody T27
Classification HYDROLASE
Compound Cystic fibrosis transmembrane conductance regulator
Source (6GJQ)
Sequence A:  DINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSRISF
CPQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDI
SKFPEKDNTVLGEGGITLSGGQRARISLARAVYKDADLYL
LDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHL
KKADKILILHEGSSYFYGTFSELQNLQ
Description (1)  Cystic fibrosis transmembrane conductance regulator (E.C.3.6.3.49), Nanobody T27


Functional site

1) chain A
residue 459
type
ligand
sequence S
description binding site for residue ATP A 701
source : AC1

2) chain A
residue 460
type
ligand
sequence T
description binding site for residue ATP A 701
source : AC1

3) chain A
residue 461
type
ligand
sequence G
description binding site for residue ATP A 701
source : AC1

4) chain A
residue 462
type
ligand
sequence A
description binding site for residue ATP A 701
source : AC1

5) chain A
residue 463
type
ligand
sequence G
description binding site for residue ATP A 701
source : AC1

6) chain A
residue 464
type
ligand
sequence K
description binding site for residue ATP A 701
source : AC1

7) chain A
residue 465
type
ligand
sequence T
description binding site for residue ATP A 701
source : AC1

8) chain A
residue 466
type
ligand
sequence S
description binding site for residue ATP A 701
source : AC1

9) chain A
residue 493
type
ligand
sequence Q
description binding site for residue ATP A 701
source : AC1

10) chain A
residue 494
type
ligand
sequence F
description binding site for residue ATP E 701
source : AC3

11) chain A
residue 495
type
ligand
sequence S
description binding site for residue ATP E 701
source : AC3

12) chain A
residue 443
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence D
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_A_701

13) chain A
residue 459-466
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence STGAGKTS
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_A_701

14) chain A
residue 493
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence Q
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_A_701

15) chain A
residue 572
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence D
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_A_701

16) chain A
residue 622
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence G
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_A_701

17) chain A
residue 494-497
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence FSWI
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_E_701

18) chain A
residue 553
type binding
ligand ATP: ADENOSINE-5'-TRIPHOSPHATE
sequence R
description ADENOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : ATP_6gjq_E_701


Display surface

Download
Links