eF-site ID 6gge-B
PDB Code 6gge
Chain B

click to enlarge
Title p53 cancer mutant Y220C in complex with small-molecule stabilizer PK9327
Classification DNA BINDING PROTEIN
Compound Cellular tumor antigen p53
Source (P53_HUMAN)
Sequence B:  SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKL
FCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVV
RRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFR
HSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILT
IITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRK
Description (1)  Cellular tumor antigen p53


Functional site

1) chain B
residue 176
type
ligand
sequence C
description binding site for residue ZN B 401
source : AC3

2) chain B
residue 179
type
ligand
sequence H
description binding site for residue ZN B 401
source : AC3

3) chain B
residue 238
type
ligand
sequence C
description binding site for residue ZN B 401
source : AC3

4) chain B
residue 242
type
ligand
sequence C
description binding site for residue ZN B 401
source : AC3

5) chain B
residue 145
type
ligand
sequence L
description binding site for residue EYE B 402
source : AC4

6) chain B
residue 147
type
ligand
sequence V
description binding site for residue EYE B 402
source : AC4

7) chain B
residue 150
type
ligand
sequence T
description binding site for residue EYE B 402
source : AC4

8) chain B
residue 151
type
ligand
sequence P
description binding site for residue EYE B 402
source : AC4

9) chain B
residue 152
type
ligand
sequence P
description binding site for residue EYE B 402
source : AC4

10) chain B
residue 153
type
ligand
sequence P
description binding site for residue EYE B 402
source : AC4

11) chain B
residue 220
type
ligand
sequence C
description binding site for residue EYE B 402
source : AC4

12) chain B
residue 221
type
ligand
sequence E
description binding site for residue EYE B 402
source : AC4

13) chain B
residue 222
type
ligand
sequence P
description binding site for residue EYE B 402
source : AC4

14) chain B
residue 223
type
ligand
sequence P
description binding site for residue EYE B 402
source : AC4

15) chain B
residue 228
type
ligand
sequence D
description binding site for residue EYE B 402
source : AC4

16) chain B
residue 230
type
ligand
sequence T
description binding site for residue EYE B 402
source : AC4

17) chain B
residue 145-147
type binding
ligand EYE: [9-ethyl-7-(5-methylthiophen-2-yl)carbazol-3-yl]methyl-methyl-azanium
sequence LWV
description [9-ethyl-7-(5-methylthiophen-2-yl)carbazol-3-yl]methyl-methyl-azanium binding site
source pdb_hetatom : EYE_6gge_B_402

18) chain B
residue 150-155
type binding
ligand EYE: [9-ethyl-7-(5-methylthiophen-2-yl)carbazol-3-yl]methyl-methyl-azanium
sequence TPPPGT
description [9-ethyl-7-(5-methylthiophen-2-yl)carbazol-3-yl]methyl-methyl-azanium binding site
source pdb_hetatom : EYE_6gge_B_402

19) chain B
residue 220-223
type binding
ligand EYE: [9-ethyl-7-(5-methylthiophen-2-yl)carbazol-3-yl]methyl-methyl-azanium
sequence CEPP
description [9-ethyl-7-(5-methylthiophen-2-yl)carbazol-3-yl]methyl-methyl-azanium binding site
source pdb_hetatom : EYE_6gge_B_402

20) chain B
residue 227-230
type binding
ligand EYE: [9-ethyl-7-(5-methylthiophen-2-yl)carbazol-3-yl]methyl-methyl-azanium
sequence SDCT
description [9-ethyl-7-(5-methylthiophen-2-yl)carbazol-3-yl]methyl-methyl-azanium binding site
source pdb_hetatom : EYE_6gge_B_402


Display surface

Download
Links