eF-site ID 6gge-A
PDB Code 6gge
Chain A

click to enlarge
Title p53 cancer mutant Y220C in complex with small-molecule stabilizer PK9327
Classification DNA BINDING PROTEIN
Compound Cellular tumor antigen p53
Source (P53_HUMAN)
Sequence A:  SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFC
QLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRR
CPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHS
VVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTII
TLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRKK
Description (1)  Cellular tumor antigen p53


Functional site

1) chain A
residue 176
type
ligand
sequence C
description binding site for residue ZN A 401
source : AC1

2) chain A
residue 179
type
ligand
sequence H
description binding site for residue ZN A 401
source : AC1

3) chain A
residue 238
type
ligand
sequence C
description binding site for residue ZN A 401
source : AC1

4) chain A
residue 242
type
ligand
sequence C
description binding site for residue ZN A 401
source : AC1

5) chain A
residue 145
type
ligand
sequence L
description binding site for residue EYE A 402
source : AC2

6) chain A
residue 147
type
ligand
sequence V
description binding site for residue EYE A 402
source : AC2

7) chain A
residue 150
type
ligand
sequence T
description binding site for residue EYE A 402
source : AC2

8) chain A
residue 220
type
ligand
sequence C
description binding site for residue EYE A 402
source : AC2

9) chain A
residue 221
type
ligand
sequence E
description binding site for residue EYE A 402
source : AC2

10) chain A
residue 222
type
ligand
sequence P
description binding site for residue EYE A 402
source : AC2

11) chain A
residue 223
type
ligand
sequence P
description binding site for residue EYE A 402
source : AC2

12) chain A
residue 228
type
ligand
sequence D
description binding site for residue EYE A 402
source : AC2

13) chain A
residue 230
type
ligand
sequence T
description binding site for residue EYE A 402
source : AC2

14) chain A
residue 145-147
type binding
ligand EYE: [9-ethyl-7-(5-methylthiophen-2-yl)carbazol-3-yl]methyl-methyl-azanium
sequence LWV
description [9-ethyl-7-(5-methylthiophen-2-yl)carbazol-3-yl]methyl-methyl-azanium binding site
source pdb_hetatom : EYE_6gge_A_402

15) chain A
residue 150-155
type binding
ligand EYE: [9-ethyl-7-(5-methylthiophen-2-yl)carbazol-3-yl]methyl-methyl-azanium
sequence TPPPGT
description [9-ethyl-7-(5-methylthiophen-2-yl)carbazol-3-yl]methyl-methyl-azanium binding site
source pdb_hetatom : EYE_6gge_A_402

16) chain A
residue 220-223
type binding
ligand EYE: [9-ethyl-7-(5-methylthiophen-2-yl)carbazol-3-yl]methyl-methyl-azanium
sequence CEPP
description [9-ethyl-7-(5-methylthiophen-2-yl)carbazol-3-yl]methyl-methyl-azanium binding site
source pdb_hetatom : EYE_6gge_A_402

17) chain A
residue 227-230
type binding
ligand EYE: [9-ethyl-7-(5-methylthiophen-2-yl)carbazol-3-yl]methyl-methyl-azanium
sequence SDCT
description [9-ethyl-7-(5-methylthiophen-2-yl)carbazol-3-yl]methyl-methyl-azanium binding site
source pdb_hetatom : EYE_6gge_A_402


Display surface

Download
Links