|
click to enlarge |
||||||||||||||||||||||||
|
|||||||||||||||||||||||||
Functional site
| 1) | chain | A |
| residue | 176 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN A 401 | |
| source | : AC1 | |
| 2) | chain | A |
| residue | 179 | |
| type | ||
| sequence | H | |
| description | binding site for residue ZN A 401 | |
| source | : AC1 | |
| 3) | chain | A |
| residue | 238 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN A 401 | |
| source | : AC1 | |
| 4) | chain | A |
| residue | 242 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN A 401 | |
| source | : AC1 | |
| 5) | chain | A |
| residue | 145 | |
| type | ||
| sequence | L | |
| description | binding site for residue EXQ A 402 | |
| source | : AC2 | |
| 6) | chain | A |
| residue | 147 | |
| type | ||
| sequence | V | |
| description | binding site for residue EXQ A 402 | |
| source | : AC2 | |
| 7) | chain | A |
| residue | 150 | |
| type | ||
| sequence | T | |
| description | binding site for residue EXQ A 402 | |
| source | : AC2 | |
| 8) | chain | A |
| residue | 151 | |
| type | ||
| sequence | P | |
| description | binding site for residue EXQ A 402 | |
| source | : AC2 | |
| 9) | chain | A |
| residue | 220 | |
| type | ||
| sequence | C | |
| description | binding site for residue EXQ A 402 | |
| source | : AC2 | |
| 10) | chain | A |
| residue | 221 | |
| type | ||
| sequence | E | |
| description | binding site for residue EXQ A 402 | |
| source | : AC2 | |
| 11) | chain | A |
| residue | 222 | |
| type | ||
| sequence | P | |
| description | binding site for residue EXQ A 402 | |
| source | : AC2 | |
| 12) | chain | A |
| residue | 223 | |
| type | ||
| sequence | P | |
| description | binding site for residue EXQ A 402 | |
| source | : AC2 | |
| 13) | chain | A |
| residue | 228 | |
| type | ||
| sequence | D | |
| description | binding site for residue EXQ A 402 | |
| source | : AC2 | |
| 14) | chain | A |
| residue | 230 | |
| type | ||
| sequence | T | |
| description | binding site for residue EXQ A 402 | |
| source | : AC2 | |
| 15) | chain | A |
| residue | 131 | |
| type | ||
| sequence | N | |
| description | binding site for residue EDO A 403 | |
| source | : AC3 | |
| 16) | chain | A |
| residue | 252 | |
| type | ||
| sequence | L | |
| description | binding site for residue EDO A 403 | |
| source | : AC3 | |
| 17) | chain | A |
| residue | 269 | |
| type | ||
| sequence | S | |
| description | binding site for residue EDO A 403 | |
| source | : AC3 | |
| 18) | chain | B |
| residue | 176 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN B 401 | |
| source | : AC4 | |
| 19) | chain | B |
| residue | 179 | |
| type | ||
| sequence | H | |
| description | binding site for residue ZN B 401 | |
| source | : AC4 | |
| 20) | chain | B |
| residue | 238 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN B 401 | |
| source | : AC4 | |
| 21) | chain | B |
| residue | 242 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN B 401 | |
| source | : AC4 | |
| 22) | chain | B |
| residue | 174 | |
| type | ||
| sequence | R | |
| description | binding site for residue GOL B 402 | |
| source | : AC5 | |
| 23) | chain | B |
| residue | 192 | |
| type | ||
| sequence | Q | |
| description | binding site for residue GOL B 402 | |
| source | : AC5 | |
| 24) | chain | B |
| residue | 207 | |
| type | ||
| sequence | D | |
| description | binding site for residue GOL B 402 | |
| source | : AC5 | |
| 25) | chain | B |
| residue | 212 | |
| type | ||
| sequence | F | |
| description | binding site for residue GOL B 402 | |
| source | : AC5 | |
| 26) | chain | B |
| residue | 214 | |
| type | ||
| sequence | H | |
| description | binding site for residue GOL B 402 | |
| source | : AC5 | |
| 27) | chain | A |
| residue | 97 | |
| type | ||
| sequence | V | |
| description | binding site for residue EPE B 403 | |
| source | : AC6 | |
| 28) | chain | A |
| residue | 169 | |
| type | ||
| sequence | M | |
| description | binding site for residue EPE B 403 | |
| source | : AC6 | |
| 29) | chain | B |
| residue | 138 | |
| type | ||
| sequence | A | |
| description | binding site for residue EPE B 403 | |
| source | : AC6 | |
| 30) | chain | B |
| residue | 139 | |
| type | ||
| sequence | K | |
| description | binding site for residue EPE B 403 | |
| source | : AC6 | |
| 31) | chain | B |
| residue | 140 | |
| type | ||
| sequence | T | |
| description | binding site for residue EPE B 403 | |
| source | : AC6 | |
| 32) | chain | B |
| residue | 198 | |
| type | ||
| sequence | E | |
| description | binding site for residue EPE B 403 | |
| source | : AC6 | |
| 33) | chain | B |
| residue | 235 | |
| type | ||
| sequence | N | |
| description | binding site for residue EPE B 403 | |
| source | : AC6 | |
| 34) | chain | B |
| residue | 145 | |
| type | ||
| sequence | L | |
| description | binding site for residue EXQ B 404 | |
| source | : AC7 | |
| 35) | chain | B |
| residue | 147 | |
| type | ||
| sequence | V | |
| description | binding site for residue EXQ B 404 | |
| source | : AC7 | |
| 36) | chain | B |
| residue | 151 | |
| type | ||
| sequence | P | |
| description | binding site for residue EXQ B 404 | |
| source | : AC7 | |
| 37) | chain | B |
| residue | 220 | |
| type | ||
| sequence | C | |
| description | binding site for residue EXQ B 404 | |
| source | : AC7 | |
| 38) | chain | B |
| residue | 221 | |
| type | ||
| sequence | E | |
| description | binding site for residue EXQ B 404 | |
| source | : AC7 | |
| 39) | chain | B |
| residue | 222 | |
| type | ||
| sequence | P | |
| description | binding site for residue EXQ B 404 | |
| source | : AC7 | |
| 40) | chain | B |
| residue | 223 | |
| type | ||
| sequence | P | |
| description | binding site for residue EXQ B 404 | |
| source | : AC7 | |
| 41) | chain | B |
| residue | 228 | |
| type | ||
| sequence | D | |
| description | binding site for residue EXQ B 404 | |
| source | : AC7 | |
| 42) | chain | B |
| residue | 230 | |
| type | ||
| sequence | T | |
| description | binding site for residue EXQ B 404 | |
| source | : AC7 | |
| 43) | chain | A |
| residue | 102-292 | |
| type | DNA_BIND | |
| sequence |
TYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTC PVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHER CSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCE PPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSS GNLLGRDSFEVRVCACPGRDRRTEEENLRKK |
|
| description | DNA_BIND => ECO:0000269|PubMed:16793544, ECO:0000269|PubMed:18996393, ECO:0000269|PubMed:20364130 | |
| source | Swiss-Prot : SWS_FT_FI1 | |
| 44) | chain | A |
| residue | 120 | |
| type | MOD_RES | |
| sequence | K | |
| description | N6-acetyllysine; by KAT6A => ECO:0000269|PubMed:23431171 | |
| source | Swiss-Prot : SWS_FT_FI4 | |
| 45) | chain | B |
| residue | 120 | |
| type | MOD_RES | |
| sequence | K | |
| description | N6-acetyllysine; by KAT6A => ECO:0000269|PubMed:23431171 | |
| source | Swiss-Prot : SWS_FT_FI4 | |
| 46) | chain | A |
| residue | 183 | |
| type | MOD_RES | |
| sequence | S | |
| description | Phosphoserine; by AURKB => ECO:0000269|PubMed:20959462 | |
| source | Swiss-Prot : SWS_FT_FI5 | |
| 47) | chain | A |
| residue | 269 | |
| type | MOD_RES | |
| sequence | S | |
| description | Phosphoserine; by AURKB => ECO:0000269|PubMed:20959462 | |
| source | Swiss-Prot : SWS_FT_FI5 | |
| 48) | chain | B |
| residue | 183 | |
| type | MOD_RES | |
| sequence | S | |
| description | Phosphoserine; by AURKB => ECO:0000269|PubMed:20959462 | |
| source | Swiss-Prot : SWS_FT_FI5 | |
| 49) | chain | B |
| residue | 269 | |
| type | MOD_RES | |
| sequence | S | |
| description | Phosphoserine; by AURKB => ECO:0000269|PubMed:20959462 | |
| source | Swiss-Prot : SWS_FT_FI5 | |
| 50) | chain | A |
| residue | 284 | |
| type | MOD_RES | |
| sequence | T | |
| description | Phosphothreonine; by AURKB => ECO:0000269|PubMed:20959462 | |
| source | Swiss-Prot : SWS_FT_FI6 | |
| 51) | chain | B |
| residue | 284 | |
| type | MOD_RES | |
| sequence | T | |
| description | Phosphothreonine; by AURKB => ECO:0000269|PubMed:20959462 | |
| source | Swiss-Prot : SWS_FT_FI6 | |
| 52) | chain | A |
| residue | 291 | |
| type | CROSSLNK | |
| sequence | K | |
| description | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:19536131 | |
| source | Swiss-Prot : SWS_FT_FI8 | |
| 53) | chain | A |
| residue | 292 | |
| type | CROSSLNK | |
| sequence | K | |
| description | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:19536131 | |
| source | Swiss-Prot : SWS_FT_FI8 | |
| 54) | chain | B |
| residue | 291 | |
| type | CROSSLNK | |
| sequence | K | |
| description | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:19536131 | |
| source | Swiss-Prot : SWS_FT_FI8 | |
| 55) | chain | A |
| residue | 176 | |
| type | BINDING | |
| sequence | C | |
| description | BINDING => ECO:0000269|PubMed:14534297, ECO:0000269|PubMed:16793544, ECO:0000269|PubMed:17015838, ECO:0000269|PubMed:18650397, ECO:0000269|PubMed:19515728, ECO:0000269|PubMed:20142040, ECO:0000269|PubMed:20364130 | |
| source | Swiss-Prot : SWS_FT_FI2 | |
| 56) | chain | A |
| residue | 179 | |
| type | BINDING | |
| sequence | H | |
| description | BINDING => ECO:0000269|PubMed:14534297, ECO:0000269|PubMed:16793544, ECO:0000269|PubMed:17015838, ECO:0000269|PubMed:18650397, ECO:0000269|PubMed:19515728, ECO:0000269|PubMed:20142040, ECO:0000269|PubMed:20364130 | |
| source | Swiss-Prot : SWS_FT_FI2 | |
| 57) | chain | A |
| residue | 238 | |
| type | BINDING | |
| sequence | C | |
| description | BINDING => ECO:0000269|PubMed:14534297, ECO:0000269|PubMed:16793544, ECO:0000269|PubMed:17015838, ECO:0000269|PubMed:18650397, ECO:0000269|PubMed:19515728, ECO:0000269|PubMed:20142040, ECO:0000269|PubMed:20364130 | |
| source | Swiss-Prot : SWS_FT_FI2 | |
| 58) | chain | A |
| residue | 242 | |
| type | BINDING | |
| sequence | C | |
| description | BINDING => ECO:0000269|PubMed:14534297, ECO:0000269|PubMed:16793544, ECO:0000269|PubMed:17015838, ECO:0000269|PubMed:18650397, ECO:0000269|PubMed:19515728, ECO:0000269|PubMed:20142040, ECO:0000269|PubMed:20364130 | |
| source | Swiss-Prot : SWS_FT_FI2 | |
| 59) | chain | B |
| residue | 176 | |
| type | BINDING | |
| sequence | C | |
| description | BINDING => ECO:0000269|PubMed:14534297, ECO:0000269|PubMed:16793544, ECO:0000269|PubMed:17015838, ECO:0000269|PubMed:18650397, ECO:0000269|PubMed:19515728, ECO:0000269|PubMed:20142040, ECO:0000269|PubMed:20364130 | |
| source | Swiss-Prot : SWS_FT_FI2 | |
| 60) | chain | B |
| residue | 179 | |
| type | BINDING | |
| sequence | H | |
| description | BINDING => ECO:0000269|PubMed:14534297, ECO:0000269|PubMed:16793544, ECO:0000269|PubMed:17015838, ECO:0000269|PubMed:18650397, ECO:0000269|PubMed:19515728, ECO:0000269|PubMed:20142040, ECO:0000269|PubMed:20364130 | |
| source | Swiss-Prot : SWS_FT_FI2 | |
| 61) | chain | B |
| residue | 238 | |
| type | BINDING | |
| sequence | C | |
| description | BINDING => ECO:0000269|PubMed:14534297, ECO:0000269|PubMed:16793544, ECO:0000269|PubMed:17015838, ECO:0000269|PubMed:18650397, ECO:0000269|PubMed:19515728, ECO:0000269|PubMed:20142040, ECO:0000269|PubMed:20364130 | |
| source | Swiss-Prot : SWS_FT_FI2 | |
| 62) | chain | B |
| residue | 242 | |
| type | BINDING | |
| sequence | C | |
| description | BINDING => ECO:0000269|PubMed:14534297, ECO:0000269|PubMed:16793544, ECO:0000269|PubMed:17015838, ECO:0000269|PubMed:18650397, ECO:0000269|PubMed:19515728, ECO:0000269|PubMed:20142040, ECO:0000269|PubMed:20364130 | |
| source | Swiss-Prot : SWS_FT_FI2 | |
| 63) | chain | A |
| residue | 120 | |
| type | SITE | |
| sequence | K | |
| description | Interaction with DNA => ECO:0000269|PubMed:16793544, ECO:0000269|PubMed:18996393, ECO:0000269|PubMed:20364130 | |
| source | Swiss-Prot : SWS_FT_FI3 | |
| 64) | chain | B |
| residue | 120 | |
| type | SITE | |
| sequence | K | |
| description | Interaction with DNA => ECO:0000269|PubMed:16793544, ECO:0000269|PubMed:18996393, ECO:0000269|PubMed:20364130 | |
| source | Swiss-Prot : SWS_FT_FI3 | |