eF-site ID 6gga-B
PDB Code 6gga
Chain B

click to enlarge
Title p53 cancer mutant Y220C in complex with small-molecule stabilizer PK9284
Classification DNA BINDING PROTEIN
Compound Cellular tumor antigen p53
Source (P53_HUMAN)
Sequence B:  SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKL
FCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVV
RRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFR
HSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILT
IITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRK
Description (1)  Cellular tumor antigen p53


Functional site

1) chain B
residue 145
type
ligand
sequence L
description binding site for residue EY2 B 401
source : AC3

2) chain B
residue 147
type
ligand
sequence V
description binding site for residue EY2 B 401
source : AC3

3) chain B
residue 150
type
ligand
sequence T
description binding site for residue EY2 B 401
source : AC3

4) chain B
residue 220
type
ligand
sequence C
description binding site for residue EY2 B 401
source : AC3

5) chain B
residue 221
type
ligand
sequence E
description binding site for residue EY2 B 401
source : AC3

6) chain B
residue 222
type
ligand
sequence P
description binding site for residue EY2 B 401
source : AC3

7) chain B
residue 223
type
ligand
sequence P
description binding site for residue EY2 B 401
source : AC3

8) chain B
residue 228
type
ligand
sequence D
description binding site for residue EY2 B 401
source : AC3

9) chain B
residue 230
type
ligand
sequence T
description binding site for residue EY2 B 401
source : AC3

10) chain B
residue 176
type
ligand
sequence C
description binding site for residue ZN B 402
source : AC4

11) chain B
residue 179
type
ligand
sequence H
description binding site for residue ZN B 402
source : AC4

12) chain B
residue 238
type
ligand
sequence C
description binding site for residue ZN B 402
source : AC4

13) chain B
residue 242
type
ligand
sequence C
description binding site for residue ZN B 402
source : AC4

14) chain B
residue 145-147
type binding
ligand EY2: (7-bromanyl-9-ethyl-carbazol-3-yl)methyl-methyl-azanium
sequence LWV
description (7-bromanyl-9-ethyl-carbazol-3-yl)methyl-methyl-azanium binding site
source pdb_hetatom : EY2_6gga_B_401

15) chain B
residue 150-152
type binding
ligand EY2: (7-bromanyl-9-ethyl-carbazol-3-yl)methyl-methyl-azanium
sequence TPP
description (7-bromanyl-9-ethyl-carbazol-3-yl)methyl-methyl-azanium binding site
source pdb_hetatom : EY2_6gga_B_401

16) chain B
residue 220-223
type binding
ligand EY2: (7-bromanyl-9-ethyl-carbazol-3-yl)methyl-methyl-azanium
sequence CEPP
description (7-bromanyl-9-ethyl-carbazol-3-yl)methyl-methyl-azanium binding site
source pdb_hetatom : EY2_6gga_B_401

17) chain B
residue 228-230
type binding
ligand EY2: (7-bromanyl-9-ethyl-carbazol-3-yl)methyl-methyl-azanium
sequence DCT
description (7-bromanyl-9-ethyl-carbazol-3-yl)methyl-methyl-azanium binding site
source pdb_hetatom : EY2_6gga_B_401


Display surface

Download
Links