eF-site ID 6gg7-ABCD
PDB Code 6gg7
Chain A, B, C, D

click to enlarge
Title cyanobacterial GAPDH with full-length CP12
Classification PHOTOSYNTHESIS
Compound Glyceraldehyde-3-phosphate dehydrogenase
Source (Q8DHX3_THEEB)
Sequence A:  SMVRVAINGFGRIGRNFMRCWLQRKANSKLEIVGINDTSD
PRTNAHLLKYDSMLGIFQDAEITADDDCIYAGGHAVKCVS
DRNPENLPWSAWGIDLVIEATGVFTSREGASKHLSAGAKK
VLITAPGKGNIPTYVVGVNHHTYDPSEDIVSNASCTTNCL
APIVKVLHEAFGIQQGMMTTTHSYTGDQRLLDASHRDLRR
ARAAAMNIVPTSTGAAKAVGLVIPELQGKLNGIALRVPTP
NVSVVDFVAQVEKPTIAEQVNQVIKEASETTMKGIIHYSE
LELVSSDYRGHNASSILDASLTMVLGGNLVKVVAWYDNEW
GYSQRVLDLAEHMAAHWA
B:  SMVRVAINGFGRIGRNFMRCWLQRKANSKLEIVGINDTSD
PRTNAHLLKYDSMLGIFQDAEITADDDCIYAGGHAVKCVS
DRNPENLPWSAWGIDLVIEATGVFTSREGASKHLSAGAKK
VLITAPGKGNIPTYVVGVNHHTYDPSEDIVSNASCTTNCL
APIVKVLHEAFGIQQGMMTTTHSYTGDQRLLDASHRDLRR
ARAAAMNIVPTSTGAAKAVGLVIPELQGKLNGIALRVPTP
NVSVVDFVAQVEKPTIAEQVNQVIKEASETTMKGIIHYSE
LELVSSDYRGHNASSILDASLTMVLGGNLVKVVAWYDNEW
GYSQRVLDLAEHMAAHWA
C:  KTSFQQYCDDNPDAAECRIYDD
D:  KTSFQQYCDDNPDAAECRIYDD
Description (1)  Glyceraldehyde-3-phosphate dehydrogenase (E.C.1.2.1.-), CP12 polypeptide


Functional site

1) chain B
residue 8
type
ligand
sequence G
description binding site for residue NAD B 1001
source : AC1

2) chain B
residue 9
type
ligand
sequence F
description binding site for residue NAD B 1001
source : AC1

3) chain B
residue 10
type
ligand
sequence G
description binding site for residue NAD B 1001
source : AC1

4) chain B
residue 11
type
ligand
sequence R
description binding site for residue NAD B 1001
source : AC1

5) chain B
residue 12
type
ligand
sequence I
description binding site for residue NAD B 1001
source : AC1

6) chain B
residue 35
type
ligand
sequence N
description binding site for residue NAD B 1001
source : AC1

7) chain B
residue 36
type
ligand
sequence D
description binding site for residue NAD B 1001
source : AC1

8) chain B
residue 37
type
ligand
sequence T
description binding site for residue NAD B 1001
source : AC1

9) chain B
residue 81
type
ligand
sequence R
description binding site for residue NAD B 1001
source : AC1

10) chain B
residue 99
type
ligand
sequence A
description binding site for residue NAD B 1001
source : AC1

11) chain B
residue 100
type
ligand
sequence T
description binding site for residue NAD B 1001
source : AC1

12) chain B
residue 101
type
ligand
sequence G
description binding site for residue NAD B 1001
source : AC1

13) chain B
residue 103
type
ligand
sequence F
description binding site for residue NAD B 1001
source : AC1

14) chain B
residue 123
type
ligand
sequence T
description binding site for residue NAD B 1001
source : AC1

15) chain B
residue 124
type
ligand
sequence A
description binding site for residue NAD B 1001
source : AC1

16) chain B
residue 154
type
ligand
sequence C
description binding site for residue NAD B 1001
source : AC1

17) chain B
residue 317
type
ligand
sequence N
description binding site for residue NAD B 1001
source : AC1

18) chain B
residue 321
type
ligand
sequence Y
description binding site for residue NAD B 1001
source : AC1

19) chain C
residue 66
type
ligand
sequence D
description binding site for residue NAD B 1001
source : AC1

20) chain C
residue 71
type
ligand
sequence R
description binding site for residue NAD B 1001
source : AC1

21) chain C
residue 73
type
ligand
sequence Y
description binding site for residue NAD B 1001
source : AC1

22) chain A
residue 8
type
ligand
sequence G
description binding site for residue NAD A 1001
source : AC2

23) chain A
residue 9
type
ligand
sequence F
description binding site for residue NAD A 1001
source : AC2

24) chain A
residue 10
type
ligand
sequence G
description binding site for residue NAD A 1001
source : AC2

25) chain A
residue 11
type
ligand
sequence R
description binding site for residue NAD A 1001
source : AC2

26) chain A
residue 12
type
ligand
sequence I
description binding site for residue NAD A 1001
source : AC2

27) chain A
residue 35
type
ligand
sequence N
description binding site for residue NAD A 1001
source : AC2

28) chain A
residue 36
type
ligand
sequence D
description binding site for residue NAD A 1001
source : AC2

29) chain A
residue 37
type
ligand
sequence T
description binding site for residue NAD A 1001
source : AC2

30) chain A
residue 81
type
ligand
sequence R
description binding site for residue NAD A 1001
source : AC2

31) chain A
residue 99
type
ligand
sequence A
description binding site for residue NAD A 1001
source : AC2

32) chain A
residue 100
type
ligand
sequence T
description binding site for residue NAD A 1001
source : AC2

33) chain A
residue 101
type
ligand
sequence G
description binding site for residue NAD A 1001
source : AC2

34) chain A
residue 103
type
ligand
sequence F
description binding site for residue NAD A 1001
source : AC2

35) chain A
residue 123
type
ligand
sequence T
description binding site for residue NAD A 1001
source : AC2

36) chain A
residue 124
type
ligand
sequence A
description binding site for residue NAD A 1001
source : AC2

37) chain A
residue 154
type
ligand
sequence C
description binding site for residue NAD A 1001
source : AC2

38) chain A
residue 317
type
ligand
sequence N
description binding site for residue NAD A 1001
source : AC2

39) chain A
residue 321
type
ligand
sequence Y
description binding site for residue NAD A 1001
source : AC2

40) chain D
residue 66
type
ligand
sequence D
description binding site for residue NAD A 1001
source : AC2

41) chain D
residue 73
type
ligand
sequence Y
description binding site for residue NAD A 1001
source : AC2

42) chain B
residue 7-13
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence NGFGRIG
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gg7_B_1001

43) chain B
residue 35-37
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence NDT
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gg7_B_1001

44) chain B
residue 80-81
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence DR
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gg7_B_1001

45) chain B
residue 99-104
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence ATGVFT
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gg7_B_1001

46) chain B
residue 123-124
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence TA
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gg7_B_1001

47) chain B
residue 153-154
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence SC
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gg7_B_1001

48) chain B
residue 181
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence H
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gg7_B_1001

49) chain B
residue 184-185
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence TG
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gg7_B_1001

50) chain B
residue 317-318
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence NE
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gg7_B_1001

51) chain B
residue 321
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence Y
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gg7_B_1001

52) chain C
residue 66
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence D
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gg7_B_1001

53) chain C
residue 71
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence R
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gg7_B_1001

54) chain C
residue 73-75
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence YDD
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gg7_B_1001

55) chain A
residue 191
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence D
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gg7_B_1001

56) chain A
residue 193
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence S
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gg7_B_1001

57) chain D
residue 69
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence E
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gg7_B_1001

58) chain B
residue 191
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence D
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gg7_A_1001

59) chain B
residue 193
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence S
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gg7_A_1001

60) chain C
residue 69
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence E
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gg7_A_1001

61) chain A
residue 7-13
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence NGFGRIG
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gg7_A_1001

62) chain A
residue 35-37
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence NDT
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gg7_A_1001

63) chain A
residue 80-81
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence DR
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gg7_A_1001

64) chain A
residue 99-104
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence ATGVFT
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gg7_A_1001

65) chain A
residue 123-124
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence TA
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gg7_A_1001

66) chain A
residue 153-154
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence SC
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gg7_A_1001

67) chain A
residue 181
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence H
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gg7_A_1001

68) chain A
residue 184-185
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence TG
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gg7_A_1001

69) chain A
residue 317-318
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence NE
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gg7_A_1001

70) chain A
residue 321
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence Y
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gg7_A_1001

71) chain D
residue 66
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence D
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gg7_A_1001

72) chain D
residue 71
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence R
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gg7_A_1001

73) chain D
residue 73-75
type binding
ligand NAD: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
sequence YDD
description NICOTINAMIDE-ADENINE-DINUCLEOTIDE binding site
source pdb_hetatom : NAD_6gg7_A_1001


Display surface

Download
Links